BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10b08r (739 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 25 0.64 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 25 0.64 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 25 0.64 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 25 0.64 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 25 0.64 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 25 0.64 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 25 0.64 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 25 0.64 DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 24 1.1 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 24 1.5 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 23 3.4 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 22 4.5 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 25.0 bits (52), Expect = 0.64 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -2 Query: 597 VEPALPLHSYRGPPVG*SLRKFYCDYTML 511 V P P H Y P G L+ DYT L Sbjct: 48 VAPQYPQHPYAAPAPGHGLQPTMGDYTQL 76 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 25.0 bits (52), Expect = 0.64 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -2 Query: 597 VEPALPLHSYRGPPVG*SLRKFYCDYTML 511 V P P H Y P G L+ DYT L Sbjct: 48 VAPQYPQHPYAAPAPGHGLQPTMGDYTQL 76 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 25.0 bits (52), Expect = 0.64 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -2 Query: 597 VEPALPLHSYRGPPVG*SLRKFYCDYTML 511 V P P H Y P G L+ DYT L Sbjct: 48 VAPQYPQHPYAAPAPGHGLQPTMGDYTQL 76 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 25.0 bits (52), Expect = 0.64 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -2 Query: 597 VEPALPLHSYRGPPVG*SLRKFYCDYTML 511 V P P H Y P G L+ DYT L Sbjct: 48 VAPQYPQHPYAAPAPGHGLQPTMGDYTQL 76 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 25.0 bits (52), Expect = 0.64 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -2 Query: 597 VEPALPLHSYRGPPVG*SLRKFYCDYTML 511 V P P H Y P G L+ DYT L Sbjct: 48 VAPQYPQHPYAAPAPGHGLQPTMGDYTQL 76 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 25.0 bits (52), Expect = 0.64 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -2 Query: 597 VEPALPLHSYRGPPVG*SLRKFYCDYTML 511 V P P H Y P G L+ DYT L Sbjct: 48 VAPQYPQHPYAAPAPGHGLQPTMGDYTQL 76 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 25.0 bits (52), Expect = 0.64 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -2 Query: 597 VEPALPLHSYRGPPVG*SLRKFYCDYTML 511 V P P H Y P G L+ DYT L Sbjct: 48 VAPQYPQHPYAAPAPGHGLQPTMGDYTQL 76 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 25.0 bits (52), Expect = 0.64 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -2 Query: 597 VEPALPLHSYRGPPVG*SLRKFYCDYTML 511 V P P H Y P G L+ DYT L Sbjct: 48 VAPQYPQHPYAAPAPGHGLQPTMGDYTQL 76 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 24.2 bits (50), Expect = 1.1 Identities = 12/52 (23%), Positives = 23/52 (44%) Frame = +3 Query: 507 RITLCNRNKICVMTTQQEGPCMSAVGGRARPGETRRVHPSDTLVPECTLPPC 662 +I R+ +C + + +S +A+PGE + + + EC PC Sbjct: 79 KIWQMERSCMCCQESGEREASVSLFCPKAKPGERKFIKVTTKAPLECMCRPC 130 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = -2 Query: 591 PALPLHSYRGPPVG*SLRKFYCDYTML 511 P P H Y P G L+ DYT L Sbjct: 6 PQYPQHPYAAPAPGHGLQPTMGDYTQL 32 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 621 GGLGASLLVEPALPLHSYRGPPVG 550 G S+ + +P H Y GPP G Sbjct: 48 GSCDPSVGLRQGIPPHHYGGPPSG 71 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 22.2 bits (45), Expect = 4.5 Identities = 14/61 (22%), Positives = 27/61 (44%) Frame = -2 Query: 633 VCRRGGLGASLLVEPALPLHSYRGPPVG*SLRKFYCDYTMLFFPKEVILEQKFSANFIRI 454 V +RG + + + + Y GP +L FY +T +F +++I + A + Sbjct: 338 VAKRGSITSKNVANKIRDFY-YEGPNSENNLDNFYLIHTDTYFLRDIIFAIRQHAITAKF 396 Query: 453 P 451 P Sbjct: 397 P 397 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,535 Number of Sequences: 336 Number of extensions: 4161 Number of successful extensions: 22 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19779950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -