BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10b08r (739 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY330178-1|AAQ16284.1| 176|Anopheles gambiae odorant-binding pr... 24 5.6 AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding pr... 24 5.6 AJ618921-1|CAF02000.1| 172|Anopheles gambiae putative odorant-b... 24 5.6 >AY330178-1|AAQ16284.1| 176|Anopheles gambiae odorant-binding protein AgamOBP51 protein. Length = 176 Score = 23.8 bits (49), Expect = 5.6 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = -3 Query: 317 AAVCADTRPLPVLAIGCALRHNNLKVPHVTVALCACGAQCVYR 189 A+ C L + G L K P+ T+ CG C YR Sbjct: 36 ASCCQLEEFLTLKTYGNCLNTMAEKYPNSTLDYLVCGLDCTYR 78 >AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding protein OBPjj5a protein. Length = 272 Score = 23.8 bits (49), Expect = 5.6 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = -3 Query: 317 AAVCADTRPLPVLAIGCALRHNNLKVPHVTVALCACGAQCVYR 189 A+ C L + G L K P+ T+ CG C YR Sbjct: 38 ASCCQLEEFLTLKTYGNCLNTMAEKYPNSTLDYLVCGLDCTYR 80 >AJ618921-1|CAF02000.1| 172|Anopheles gambiae putative odorant-binding protein OBP5479 protein. Length = 172 Score = 23.8 bits (49), Expect = 5.6 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = -3 Query: 317 AAVCADTRPLPVLAIGCALRHNNLKVPHVTVALCACGAQCVYR 189 A+ C L + G L K P+ T+ CG C YR Sbjct: 38 ASCCQLEEFLTLKTYGNCLNTMAEKYPNSTLDYLVCGLDCTYR 80 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 855,544 Number of Sequences: 2352 Number of extensions: 18701 Number of successful extensions: 45 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -