BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10b08r (739 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC012934-1|AAH12934.1| 311|Homo sapiens forkhead box R2 protein. 32 2.5 AL590383-2|CAH71374.2| 2279|Homo sapiens zinc finger protein 318... 31 5.7 AL583834-6|CAI14459.2| 2279|Homo sapiens zinc finger protein 318... 31 5.7 >BC012934-1|AAH12934.1| 311|Homo sapiens forkhead box R2 protein. Length = 311 Score = 31.9 bits (69), Expect = 2.5 Identities = 12/44 (27%), Positives = 26/44 (59%) Frame = -3 Query: 620 VDSARLSWSSPPSHCTHTGALLLGSHYANFIAITQCYSFRKKSF 489 +++ SW PP +C+H AL L ++ +++ + Y+F ++ F Sbjct: 183 INNQEKSWQRPPLNCSHLIALALRNNPHCGLSVQEIYNFTRQHF 226 >AL590383-2|CAH71374.2| 2279|Homo sapiens zinc finger protein 318 protein. Length = 2279 Score = 30.7 bits (66), Expect = 5.7 Identities = 24/58 (41%), Positives = 26/58 (44%) Frame = -1 Query: 730 RLVSVAAPTSGCCSITRSRGPRSQGGNVHSGTSVSEGWTRRVSPGRARPPTALIQGPS 557 R S P SG S T +R PRS G+ S S RRVSP PP A PS Sbjct: 37 RRSSPPPPPSGSSSRTPARRPRSPSGHRGRRASPSPPRGRRVSPS---PPRARRGSPS 91 >AL583834-6|CAI14459.2| 2279|Homo sapiens zinc finger protein 318 protein. Length = 2279 Score = 30.7 bits (66), Expect = 5.7 Identities = 24/58 (41%), Positives = 26/58 (44%) Frame = -1 Query: 730 RLVSVAAPTSGCCSITRSRGPRSQGGNVHSGTSVSEGWTRRVSPGRARPPTALIQGPS 557 R S P SG S T +R PRS G+ S S RRVSP PP A PS Sbjct: 37 RRSSPPPPPSGSSSRTPARRPRSPSGHRGRRASPSPPRGRRVSPS---PPRARRGSPS 91 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,429,889 Number of Sequences: 237096 Number of extensions: 2834917 Number of successful extensions: 8021 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7212 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8020 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8791154398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -