BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10b07f (547 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g35070.1 68417.m04978 expressed protein 29 2.0 At5g18180.1 68418.m02134 Gar1 RNA-binding region family protein ... 28 3.5 At5g41520.1 68418.m05044 40S ribosomal protein S10 (RPS10B) cont... 27 8.2 At4g14280.1 68417.m02201 hypothetical protein 27 8.2 At2g36910.1 68415.m04527 multidrug resistance P-glycoprotein (PG... 27 8.2 >At4g35070.1 68417.m04978 expressed protein Length = 265 Score = 29.1 bits (62), Expect = 2.0 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = +3 Query: 321 CRGRGRFNFRHSPVQKLGTKRISLQCTNLGTLRLICPPVKHMCICL 458 C G G N P +K+ C + G R++ P +H+C C+ Sbjct: 197 CGGEGDGN--SLPAKKMKMSSCCCNCGSNGVTRVLFLPCRHLCCCM 240 >At5g18180.1 68418.m02134 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 189 Score = 28.3 bits (60), Expect = 3.5 Identities = 16/34 (47%), Positives = 18/34 (52%), Gaps = 3/34 (8%) Frame = +3 Query: 267 QGRPSPGSRG---VPVRDRPPCRGRGRFNFRHSP 359 Q + G RG VP R R P RGRG F R +P Sbjct: 133 QPKGQSGGRGEGRVPPRGRGPPRGRGNFRGRGAP 166 >At5g41520.1 68418.m05044 40S ribosomal protein S10 (RPS10B) contains similarity to 40S ribosomal protein S10 Length = 180 Score = 27.1 bits (57), Expect = 8.2 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = -2 Query: 333 PAPDKADGRELGHPYFPGSD---GPDASTGGRRVPHVDSLRAGCRS 205 PA K + LG P+ G D GP G RR D R G +S Sbjct: 89 PATLKKQQKPLGRPFGGGGDRPRGPPRGDGERRFGDRDGYRGGPKS 134 >At4g14280.1 68417.m02201 hypothetical protein Length = 798 Score = 27.1 bits (57), Expect = 8.2 Identities = 18/43 (41%), Positives = 22/43 (51%) Frame = -3 Query: 296 TPTSRARTALTRLPAGAVYLTLTACELAVAARVTTKLRNSLSF 168 TP R T L +PA LTL A LAV ++ + L SL F Sbjct: 27 TPEPRRPTQLPPVPAPEKKLTLFALRLAVLEKIASGL-GSLGF 68 >At2g36910.1 68415.m04527 multidrug resistance P-glycoprotein (PGP1) identical to P-glycoprotein GI:3849833 from [Arabidopsis thaliana]; homologous to mammalian mdr gene,contains ATP-binding cassette; related to multi drug resistance proteins Length = 1286 Score = 27.1 bits (57), Expect = 8.2 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 372 RVSELESDES*TDPAPDKADGR-ELGHPYFPGSDGPD 265 R +E+E D+ T P PD+ G EL H F PD Sbjct: 1002 RKTEIEPDDPDTTPVPDRLRGEVELKHIDFSYPSRPD 1038 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,730,855 Number of Sequences: 28952 Number of extensions: 182376 Number of successful extensions: 422 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 422 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1023490624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -