BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10b05r (567 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor prot... 23 2.8 S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor prot... 23 2.8 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 3.7 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 21 6.5 >S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor protein. Length = 169 Score = 22.6 bits (46), Expect = 2.8 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -2 Query: 128 TRSFCFFVCTKNSFSPFF 75 T +FC C N +PFF Sbjct: 41 TNAFCLPFCGPNVINPFF 58 >S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor protein. Length = 168 Score = 22.6 bits (46), Expect = 2.8 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -2 Query: 128 TRSFCFFVCTKNSFSPFF 75 T +FC C N +PFF Sbjct: 40 TNAFCLPFCGPNVINPFF 57 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.2 bits (45), Expect = 3.7 Identities = 15/55 (27%), Positives = 24/55 (43%) Frame = +1 Query: 277 VDPRTRTALTRLPAGAVNLTLTTRELIVAARLTTKLRKSLSLEVILPILKALALS 441 V + + L R PAG+V+ +VA T + K ++ ILK + S Sbjct: 74 VHAQVYSCLARSPAGSVHSRDVNVRAVVAQYYDTDVNKEYAIRGNSAILKCVVPS 128 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.4 bits (43), Expect = 6.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 137 VNVQNMHFSVPKFVR*SEI 193 +NV++M F V FVR S I Sbjct: 25 INVEDMDFRVDMFVRQSWI 43 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,428 Number of Sequences: 438 Number of extensions: 2255 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16440594 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -