BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10b03f (573 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 24 3.1 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 24 4.0 Y17689-1|CAA76814.1| 111|Anopheles gambiae gSG2 protein protein. 23 5.3 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 23 5.3 AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. 23 5.3 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 23 7.1 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 7.1 DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. 23 9.3 AJ007394-1|CAA07489.1| 112|Anopheles gambiae mucin protein. 23 9.3 AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. 23 9.3 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 23 9.3 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 24.2 bits (50), Expect = 3.1 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = -3 Query: 247 EQVRRRWARRCQQEQVQQR 191 +Q R+RW ++ Q++Q QQR Sbjct: 188 DQQRQRWRQQQQKQQRQQR 206 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 23.8 bits (49), Expect = 4.0 Identities = 8/36 (22%), Positives = 18/36 (50%) Frame = +1 Query: 247 LVDTYEPISVGPAIVEGAPVTVTGADGTPLVQIIIN 354 +++ + + +EG +TV DG P+ + +N Sbjct: 390 MINAFASVCPAQVTIEGHALTVIATDGEPVHPVQVN 425 >Y17689-1|CAA76814.1| 111|Anopheles gambiae gSG2 protein protein. Length = 111 Score = 23.4 bits (48), Expect = 5.3 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -1 Query: 573 GLGKSDSGSRDDRGTNNYGLDDFG 502 G G+S + S + GT+ GL DFG Sbjct: 37 GTGQSFNFSGESNGTSIPGLPDFG 60 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 23.4 bits (48), Expect = 5.3 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +3 Query: 483 APQPCPPRSRQARNCWYPYHPGSRCHSSRD 572 A P PP ++ C H S C S+ D Sbjct: 497 AAPPTPPERQRCFRCLEMGHIASNCRSTAD 526 >AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. Length = 114 Score = 23.4 bits (48), Expect = 5.3 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -1 Query: 573 GLGKSDSGSRDDRGTNNYGLDDFG 502 G G+S + S + GT+ GL DFG Sbjct: 37 GTGQSFNFSGESNGTSIPGLPDFG 60 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.0 bits (47), Expect = 7.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 Query: 400 DIAEEPLPEVVILPTPVFPEI 462 D+ E P I+P P FP+I Sbjct: 546 DMKEAPTTNPRIVPIPTFPQI 566 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.0 bits (47), Expect = 7.1 Identities = 35/156 (22%), Positives = 55/156 (35%), Gaps = 7/156 (4%) Frame = -1 Query: 567 GKSDSGSRDDRGTNNYGLDDFGEDRAGELHGFRNVDFRKYGSGE-------NNNFGQRLF 409 G S R ++ G D E+ GE G R + G+ + Q+ Sbjct: 950 GGGGSRKRKEKARRGSGGDSDSEEEEGE--GSRKRKKKGASGGQKKRQKAMDEGLSQKQK 1007 Query: 408 GNVLNINGISGNLGRTVHVDDDLDEGSAISAGDSHRGTFNNGRSNRDGLVGVNKSRSDGD 229 G +L+ +S T D D D I++GD G + R + ++ SDG Sbjct: 1008 GRILSKATVS-----TSESDSD-DSRLKIASGDESGGESGAPATKRKRRIASDEEDSDGS 1061 Query: 228 GLVGVNKSRSNRDGHVGVNKSRSNRDGFVGVNKSRS 121 ++SRS +R G + SRS Sbjct: 1062 QRRSRSRSRSGSGSRSRSRSGSGSRAGSRAGSGSRS 1097 >DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. Length = 595 Score = 22.6 bits (46), Expect = 9.3 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +1 Query: 214 DTYEPISVGPALVDTYEPISVGPAIVEGAPVT 309 +T E +V P DT EP+++ P+T Sbjct: 433 ETMEQTTVVPEAADTTEPLTIETTSQSFVPLT 464 >AJ007394-1|CAA07489.1| 112|Anopheles gambiae mucin protein. Length = 112 Score = 22.6 bits (46), Expect = 9.3 Identities = 11/33 (33%), Positives = 13/33 (39%) Frame = +1 Query: 232 SVGPALVDTYEPISVGPAIVEGAPVTVTGADGT 330 +V P T P V PVT TG+ T Sbjct: 50 TVAPTTTTTVAPGQTTTTTVASGPVTTTGSTDT 82 >AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. Length = 122 Score = 22.6 bits (46), Expect = 9.3 Identities = 13/51 (25%), Positives = 17/51 (33%) Frame = +1 Query: 178 TYVPISVGPALVDTYEPISVGPALVDTYEPISVGPAIVEGAPVTVTGADGT 330 T P + T ++ G T P V PVT TG+ T Sbjct: 42 TVAPTTTTTVAPTTTTTVAPGQTTTTTVAPGQTTTTTVASGPVTTTGSTDT 92 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 22.6 bits (46), Expect = 9.3 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -3 Query: 472 QERRFQEIREWGE*QLRAKALRQCPQHQRDQRQSRK 365 Q+++ Q+ + QLR + +Q PQ Q+ QR ++ Sbjct: 441 QQQQQQQGERYVPPQLRQQRQQQQPQQQQQQRPQQQ 476 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.312 0.137 0.393 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 502,521 Number of Sequences: 2352 Number of extensions: 10382 Number of successful extensions: 27 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54245403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -