BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10b02r (710 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF125954-5|AAD14708.2| 338|Caenorhabditis elegans Seven tm rece... 29 3.3 AC006769-6|AAF60582.1| 274|Caenorhabditis elegans Hypothetical ... 29 3.3 >AF125954-5|AAD14708.2| 338|Caenorhabditis elegans Seven tm receptor protein 120 protein. Length = 338 Score = 29.1 bits (62), Expect = 3.3 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 5/72 (6%) Frame = -2 Query: 538 LHVKGFRSHLCLKRMIFTFISLRSWVYELHHVL-----HLFGKSDVMYGDTKFLILSDGS 374 +H + R H +++ S+ S +Y L VL H+ G ++Y T FL +S Sbjct: 29 IHTRATR-HFGSYKLLMASFSIFSILYALVEVLTQPIMHISGTGLMLYVGTTFLPISKEF 87 Query: 373 GNRAAPFKCNCF 338 G+ A F C+ F Sbjct: 88 GHFIAAFYCSTF 99 >AC006769-6|AAF60582.1| 274|Caenorhabditis elegans Hypothetical protein Y45G12C.6 protein. Length = 274 Score = 29.1 bits (62), Expect = 3.3 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 5/72 (6%) Frame = -2 Query: 538 LHVKGFRSHLCLKRMIFTFISLRSWVYELHHVL-----HLFGKSDVMYGDTKFLILSDGS 374 +H + R H +++ S+ S +Y L VL H+ G ++Y T FL +S Sbjct: 29 IHTRATR-HFGSYKLLMASFSIFSILYALVEVLTQPIMHISGTGLMLYVGTTFLPISKEF 87 Query: 373 GNRAAPFKCNCF 338 G+ A F C+ F Sbjct: 88 GHFIAAFYCSTF 99 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,318,891 Number of Sequences: 27780 Number of extensions: 268811 Number of successful extensions: 474 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 468 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 474 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1655655746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -