BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10b02f (573 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F10.14c |btf3|egd1, btt1, nac2|nascent polypeptide-associat... 111 7e-26 SPAC6G10.03c |||abhydrolase family protein, unknown biological r... 29 0.64 SPAC977.17 |||MIP water channel|Schizosaccharomyces pombe|chr 1|... 27 1.5 SPAC1952.02 |||ribosome biogenesis protein|Schizosaccharomyces p... 25 6.0 SPBC24C6.05 |sec28||coatomer epsilon subunit |Schizosaccharomyce... 25 6.0 SPAC343.06c |||scramblase|Schizosaccharomyces pombe|chr 1|||Manual 25 7.9 >SPAC4F10.14c |btf3|egd1, btt1, nac2|nascent polypeptide-associated complex beta subunit|Schizosaccharomyces pombe|chr 1|||Manual Length = 151 Score = 111 bits (267), Expect = 7e-26 Identities = 64/149 (42%), Positives = 84/149 (56%), Gaps = 8/149 (5%) Frame = +3 Query: 150 MNSEKLKKLQSQVRIGGKGTPRRKKKVVHVTA--ATDDXXXXXXXXXXXVNTIPGIEEVN 323 M+ KL KLQ+ RIGGKGTPRRK K +A A DD + + GI+EVN Sbjct: 1 MDPSKLAKLQAGARIGGKGTPRRKVKKPSKSAMSAADDKKVQGALKKLNMQNLAGIQEVN 60 Query: 324 MIKEDGTVIHFNNPKAQASLAANTFAITGHGENKQTTEMLPGILSQLGPDGLNRLKRIAS 503 M KEDG VI+F P +SL T AI G E K +E+LPGIL+ LGP+ L L+++A Sbjct: 61 MFKEDGGVINFRAPTVHSSLPNETTAIYGKAEEKTLSEILPGILNNLGPESLTALRQMAE 120 Query: 504 SVAAPK------PLEEDDEVPNLVGNFDE 572 + + +D E+P+LV FDE Sbjct: 121 QLKVSEGEKGADAQADDGEIPDLVEKFDE 149 >SPAC6G10.03c |||abhydrolase family protein, unknown biological role|Schizosaccharomyces pombe|chr 1|||Manual Length = 428 Score = 28.7 bits (61), Expect = 0.64 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -2 Query: 533 FLEWLRRGNTRRNPFQSVQAVGSELAEDT 447 F++WL GN+ R PF SE E+T Sbjct: 126 FVDWLGMGNSSRPPFDIKGQTASEKVEET 154 >SPAC977.17 |||MIP water channel|Schizosaccharomyces pombe|chr 1|||Manual Length = 598 Score = 27.5 bits (58), Expect = 1.5 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +3 Query: 87 NSVIKKCPVLTLTQFTLKNSRMNSEKLKKLQSQVRIGG-KGTPRRKKKV 230 NSV++K + NSR+NS + S V + G G+P K+K+ Sbjct: 131 NSVVEKISQKNQEARSRANSRVNSRANSRANSSVSLAGMDGSPNWKRKM 179 >SPAC1952.02 |||ribosome biogenesis protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 202 Score = 25.4 bits (53), Expect = 6.0 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +3 Query: 138 KNSRMNSEKLKKLQSQVRIGGKGTPRRKKKV 230 K + +KLKK ++++ T +RK+KV Sbjct: 148 KEKKEKKDKLKKKSKRLKLDDSHTQKRKRKV 178 >SPBC24C6.05 |sec28||coatomer epsilon subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 288 Score = 25.4 bits (53), Expect = 6.0 Identities = 14/68 (20%), Positives = 30/68 (44%) Frame = +3 Query: 366 KAQASLAANTFAITGHGENKQTTEMLPGILSQLGPDGLNRLKRIASSVAAPKPLEEDDEV 545 + + +L++ A+ ++ + ++ LGPD ++ K I SS L+ +D + Sbjct: 211 RPEEALSSLKTALDSQPNYEEALSNMTTAITDLGPDAPSQAKNILSSFTNSSTLKLNDHL 270 Query: 546 PNLVGNFD 569 FD Sbjct: 271 NEKAQEFD 278 >SPAC343.06c |||scramblase|Schizosaccharomyces pombe|chr 1|||Manual Length = 381 Score = 25.0 bits (52), Expect = 7.9 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 493 GLRRVLPRLSHSRKTTRYLTSSA 561 GL+R RL H K+TRY+ ++A Sbjct: 26 GLKRFGCRLYHHSKSTRYIDATA 48 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,211,507 Number of Sequences: 5004 Number of extensions: 42966 Number of successful extensions: 124 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 244081442 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -