BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10b01f (632 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g19270.1 68414.m02397 ubiquitin interaction motif-containing ... 51 6e-07 At5g17890.1 68418.m02098 LIM domain-containing protein / disease... 48 4e-06 At4g36860.1 68417.m05226 LIM domain-containing protein low simil... 48 7e-06 At5g66610.1 68418.m08396 LIM domain-containing protein contains ... 47 9e-06 At5g66620.1 68418.m08397 LIM domain-containing protein contains ... 38 0.006 At3g55770.1 68416.m06197 LIM domain-containing protein similar t... 36 0.030 At2g45800.1 68415.m05696 LIM domain-containing protein similar t... 36 0.030 At2g39900.1 68415.m04904 LIM domain-containing protein similar t... 35 0.052 At1g31250.1 68414.m03825 proline-rich family protein contains pr... 34 0.090 At5g66630.1 68418.m08398 LIM domain-containing protein contains ... 33 0.12 At5g24740.1 68418.m02920 expressed protein 32 0.28 At3g61230.1 68416.m06852 LIM domain-containing protein similar t... 32 0.36 At2g37810.1 68415.m04642 CHP-rich zinc finger protein, putative 32 0.36 At1g53450.2 68414.m06059 expressed protein 30 1.1 At1g53450.1 68414.m06058 expressed protein 30 1.1 At1g10200.1 68414.m01150 transcription factor LIM, putative stro... 30 1.1 At1g01780.1 68414.m00097 LIM domain-containing protein similar t... 30 1.1 At5g60250.1 68418.m07552 zinc finger (C3HC4-type RING finger) fa... 29 1.9 At2g39720.1 68415.m04874 zinc finger (C3HC4-type RING finger) fa... 29 1.9 At2g32450.1 68415.m03964 calcium-binding EF hand family protein ... 29 3.4 At1g75080.2 68414.m08720 brassinosteroid signalling positive reg... 29 3.4 At1g75080.1 68414.m08719 brassinosteroid signalling positive reg... 29 3.4 At4g11270.1 68417.m01823 transducin family protein / WD-40 repea... 28 4.5 At3g61360.1 68416.m06866 pentatricopeptide (PPR) repeat-containi... 28 4.5 At2g02700.1 68415.m00210 DC1 domain-containing protein contains ... 28 4.5 At1g16190.1 68414.m01939 DNA repair protein RAD23, putative simi... 28 4.5 At5g07350.1 68418.m00839 tudor domain-containing protein / nucle... 28 5.9 At2g39830.1 68415.m04892 LIM domain-containing protein contains ... 28 5.9 At1g79510.2 68414.m09269 expressed protein 28 5.9 At1g79510.1 68414.m09268 expressed protein 28 5.9 At5g58430.1 68418.m07317 exocyst subunit EXO70 family protein le... 27 7.8 At4g18780.1 68417.m02774 cellulose synthase, catalytic subunit (... 27 7.8 At3g29375.1 68416.m03690 XH domain-containing protein contains P... 27 7.8 At3g19070.1 68416.m02422 cell wall protein-related similar to ve... 27 7.8 >At1g19270.1 68414.m02397 ubiquitin interaction motif-containing protein / LIM domain-containing protein weak similarity to LIM-homeobox protein [Mus musculus] GI:2149584, Hic-5 [Mus musculus] GI:664955; contains Pfam profiles PF02809: Ubiquitin interaction motif, PF00412: LIM domain Length = 532 Score = 51.2 bits (117), Expect = 6e-07 Identities = 27/86 (31%), Positives = 38/86 (44%), Gaps = 1/86 (1%) Frame = +1 Query: 127 VCNSCDKVI-QGRIVTALNKKWHPEHFVCNTCRKPIDGAKFHQHNNGVHCVPCFTKHHSP 303 +C C+ I GR + LN WHPE F C C +PI +F N C+ + + P Sbjct: 171 ICAGCNMEIGHGRFLNCLNSLWHPECFRCYGCSQPISEYEFSTSGNYPFHKACYRERYHP 230 Query: 304 RCHGCGDPITDRVIQALGVSWHAHHF 381 +C C I A + + AH F Sbjct: 231 KCDVCSHFIPTN--HAGLIEYRAHPF 254 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 484 CKGCGNPIVDKAII-ALDAKWHRDCFTCMKCRNPVTDSTFSVMENQP 621 C GC I + L++ WH +CF C C P+++ FS N P Sbjct: 172 CAGCNMEIGHGRFLNCLNSLWHPECFRCYGCSQPISEYEFSTSGNYP 218 Score = 29.5 bits (63), Expect = 1.9 Identities = 15/66 (22%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = +1 Query: 307 CHGCGDPITD-RVIQALGVSWHAHHFVXXXXXXXXXXXXFMEQAGRPYCSDCYADKFATR 483 C GC I R + L WH F F P+ CY +++ + Sbjct: 172 CAGCNMEIGHGRFLNCLNSLWHPECFRCYGCSQPISEYEFSTSGNYPFHKACYRERYHPK 231 Query: 484 CKGCGN 501 C C + Sbjct: 232 CDVCSH 237 >At5g17890.1 68418.m02098 LIM domain-containing protein / disease resistance protein-related low similarity to disease resistance protein RPP4 [Arabidopsis thaliana] GI:20270890; contains Pfam profiles PF00412: LIM domain, PF00931: NB-ARC domain, PF00560: Leucine Rich Repeat Length = 1613 Score = 48.4 bits (110), Expect = 4e-06 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 1/85 (1%) Frame = +1 Query: 130 CNSCDKVIQGRI-VTALNKKWHPEHFVCNTCRKPIDGAKFHQHNNGVHCVPCFTKHHSPR 306 C C I+ I + A WHP+ F C CR+PI + G++ PC+ + P Sbjct: 1240 CKDCKSAIEDGISINAYGSVWHPQCFCCLRCREPIAMNEI-SDLRGMYHKPCYKELRHPN 1298 Query: 307 CHGCGDPITDRVIQALGVSWHAHHF 381 C+ C I A G+ +H H F Sbjct: 1299 CYVCEKKIPR---TAEGLKYHEHPF 1320 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +1 Query: 478 TRCKGCGNPIVDK-AIIALDAKWHRDCFTCMKCRNPVTDSTFS 603 ++CK C + I D +I A + WH CF C++CR P+ + S Sbjct: 1238 SKCKDCKSAIEDGISINAYGSVWHPQCFCCLRCREPIAMNEIS 1280 >At4g36860.1 68417.m05226 LIM domain-containing protein low similarity to LIM-domain protein [Branchiostoma floridae] GI:3360516, DRAL/Slim3/FHL2 [Homo sapiens] GI:7209525; contains Pfam profile PF00412: LIM domain Length = 351 Score = 47.6 bits (108), Expect = 7e-06 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = +1 Query: 187 WHPEHFVCNTCRKPIDGAKFHQHNNGVHCVPCFTKHHSPRCHGC 318 WHPE F CN C KPI +F N + C+ + H P+C C Sbjct: 5 WHPECFCCNACDKPIIDYEFSMSGNRPYHKLCYKEQHHPKCDVC 48 Score = 36.3 bits (80), Expect = 0.017 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 541 WHRDCFTCMKCRNPVTDSTFSVMENQP 621 WH +CF C C P+ D FS+ N+P Sbjct: 5 WHPECFCCNACDKPIIDYEFSMSGNRP 31 Score = 28.3 bits (60), Expect = 4.5 Identities = 13/50 (26%), Positives = 17/50 (34%) Frame = +1 Query: 352 LGVSWHAHHFVXXXXXXXXXXXXFMEQAGRPYCSDCYADKFATRCKGCGN 501 +G WH F F RPY CY ++ +C C N Sbjct: 1 MGGVWHPECFCCNACDKPIIDYEFSMSGNRPYHKLCYKEQHHPKCDVCHN 50 >At5g66610.1 68418.m08396 LIM domain-containing protein contains Pfam profile PF00412: LIM domain Length = 529 Score = 47.2 bits (107), Expect = 9e-06 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 3/68 (4%) Frame = +1 Query: 124 AVCNSCDKVIQ-GRIVTALNKKWHPEHFVCNTCRKPIDGAKFHQHN--NGVHCVPCFTKH 294 ++C+ C I+ GR V AL WHPE F C C KPI ++ +H +C P Sbjct: 199 SICDGCKSAIEYGRSVHALGVNWHPECFCCRYCDKPIAMHEYKEHPFWKEKYC-PFHEVD 257 Query: 295 HSPRCHGC 318 +P+C C Sbjct: 258 GTPKCCSC 265 Score = 35.5 bits (78), Expect = 0.030 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +1 Query: 484 CKGCGNPI-VDKAIIALDAKWHRDCFTCMKCRNPV 585 C GC + I +++ AL WH +CF C C P+ Sbjct: 201 CDGCKSAIEYGRSVHALGVNWHPECFCCRYCDKPI 235 Score = 33.5 bits (73), Expect = 0.12 Identities = 27/99 (27%), Positives = 35/99 (35%), Gaps = 5/99 (5%) Frame = +1 Query: 292 HHSPRCHGCGDPIT-DRVIQALGVSWHAHHFVXXXXXXXXXXXXFMEQA--GRPYCSDCY 462 H C GC I R + ALGV+WH F + E YC Sbjct: 196 HPHSICDGCKSAIEYGRSVHALGVNWHPECFCCRYCDKPIAMHEYKEHPFWKEKYCPFHE 255 Query: 463 ADKFATRCKGCG--NPIVDKAIIALDAKWHRDCFTCMKC 573 D +C C P K ++ D +W C CM+C Sbjct: 256 VDG-TPKCCSCERLEPWGTKYVMLADNRWL--CVKCMEC 291 >At5g66620.1 68418.m08397 LIM domain-containing protein contains Pfam profile PF00412: LIM domain Length = 644 Score = 37.9 bits (84), Expect = 0.006 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +1 Query: 121 PAVCNSCDKVIQ-GRIVTALNKKWHPEHFVCNTCRKPI 231 P++C C+ ++ G V L WHP F C C KPI Sbjct: 283 PSLCGGCNFAVEHGGSVNILGVLWHPGCFCCRACHKPI 320 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/35 (31%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +1 Query: 484 CKGCGNPIVDKAII-ALDAKWHRDCFTCMKCRNPV 585 C GC + + L WH CF C C P+ Sbjct: 286 CGGCNFAVEHGGSVNILGVLWHPGCFCCRACHKPI 320 >At3g55770.1 68416.m06197 LIM domain-containing protein similar to pollen specific LIM domain protein 1b [Nicotiana tabacum] GI:6467905, PGPS/D1 [Petunia x hybrida] GI:4105772; contains Pfam profile PF00412: LIM domain Length = 199 Score = 35.5 bits (78), Expect = 0.030 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +1 Query: 481 RCKGCGNPIVDKAIIALDAK-WHRDCFTCMKCRNPVTDSTFSVMENQPLC 627 +CK C + +++ D +H+ CF C C++ + S++S ME C Sbjct: 9 KCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYC 58 Score = 27.9 bits (59), Expect = 5.9 Identities = 11/53 (20%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +1 Query: 130 CNSCDKVIQG-RIVTALNKKWHPEHFVCNTCRKPIDGAKFHQHNNGVHCVPCF 285 C +C+K + +++A +H F C C+ + + + ++C P F Sbjct: 10 CKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKPHF 62 Score = 27.9 bits (59), Expect = 5.9 Identities = 10/50 (20%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 481 RCKGCGNPIVDKAIIALDAK-WHRDCFTCMKCRNPVTDSTFSVMENQPLC 627 +C C + + ++++ +H+ CF C P++ S ++ +E C Sbjct: 107 KCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYC 156 >At2g45800.1 68415.m05696 LIM domain-containing protein similar to PGPS/D1 [Petunia x hybrida] GI:4105772, LIM domain protein PLIM1 [Nicotiana tabacum] GI:5932418; contains Pfam profile PF00412: LIM domain Length = 226 Score = 35.5 bits (78), Expect = 0.030 Identities = 13/50 (26%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 481 RCKGCGNPIVDKAIIALDAK-WHRDCFTCMKCRNPVTDSTFSVMENQPLC 627 +CK C + ++ L+ +H+ CF C C+ + S +S M+ C Sbjct: 9 KCKACDKTVYVMDLLTLEGNTYHKSCFRCTHCKGTLVISNYSSMDGVLYC 58 Score = 27.5 bits (58), Expect = 7.8 Identities = 12/53 (22%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +1 Query: 130 CNSCDKVIQGR-IVTALNKKWHPEHFVCNTCRKPIDGAKFHQHNNGVHCVPCF 285 C +CDK + ++T +H F C C+ + + + + ++C P F Sbjct: 10 CKACDKTVYVMDLLTLEGNTYHKSCFRCTHCKGTLVISNYSSMDGVLYCKPHF 62 >At2g39900.1 68415.m04904 LIM domain-containing protein similar to pollen specific LIM domain protein 1b [Nicotiana tabacum] GI:6467905, PGPS/D1 [Petunia x hybrida] GI:4105772; contains Pfam profile PF00412: LIM domain Length = 200 Score = 34.7 bits (76), Expect = 0.052 Identities = 13/50 (26%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +1 Query: 481 RCKGCGNPIVDKAIIALDA-KWHRDCFTCMKCRNPVTDSTFSVMENQPLC 627 +C+ C + +++ D +H+ CF C C++ + S +S ME C Sbjct: 9 KCRACEKTVYPVELLSADGISYHKACFKCSHCKSRLQLSNYSSMEGVVYC 58 Score = 28.3 bits (60), Expect = 4.5 Identities = 12/53 (22%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +1 Query: 130 CNSCDKVIQG-RIVTALNKKWHPEHFVCNTCRKPIDGAKFHQHNNGVHCVPCF 285 C +C+K + +++A +H F C+ C+ + + + V+C P F Sbjct: 10 CRACEKTVYPVELLSADGISYHKACFKCSHCKSRLQLSNYSSMEGVVYCRPHF 62 >At1g31250.1 68414.m03825 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; similar to prolin rich protein GB:S44189 GI:433706 from [Zea mays] Length = 165 Score = 33.9 bits (74), Expect = 0.090 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +2 Query: 179 TRNGIPSTLSATPAVSQSMEPSST--STTTVSIACP-ASPNITARGAMDAATPSLT 337 T N PS P S SM P+ T ++ +V + P ASP++ G A+PSLT Sbjct: 89 TPNASPSVKLTPPYASPSMRPAGTPNASPSVKLTPPYASPSVRPTGTTPNASPSLT 144 >At5g66630.1 68418.m08398 LIM domain-containing protein contains low similarity to Pfam profile PF00412: LIM domain Length = 702 Score = 33.5 bits (73), Expect = 0.12 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +1 Query: 124 AVCNSCDKVIQGR-IVTALNKKWHPEHFVCNTCRKPIDGAKFHQH 255 ++C C+ ++ V L WHP F C +C KPI + H Sbjct: 345 SMCGGCNSAVKHEESVNILGVLWHPGCFCCRSCDKPIAIHELENH 389 Score = 32.7 bits (71), Expect = 0.21 Identities = 11/35 (31%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +1 Query: 484 CKGCGNPIV-DKAIIALDAKWHRDCFTCMKCRNPV 585 C GC + + ++++ L WH CF C C P+ Sbjct: 347 CGGCNSAVKHEESVNILGVLWHPGCFCCRSCDKPI 381 >At5g24740.1 68418.m02920 expressed protein Length = 3306 Score = 32.3 bits (70), Expect = 0.28 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -1 Query: 284 KQGTQWTPLLCWWNLAPSIGLRQVLQTKCSG 192 KQG P+ WN+ IGL V+ T CSG Sbjct: 3193 KQGFLGVPIDLVWNIEREIGLESVIHTDCSG 3223 >At3g61230.1 68416.m06852 LIM domain-containing protein similar to SP|P29675 Pollen specific protein SF3 {Helianthus annuus}; contains Pfam profile PF00412: LIM domain Length = 213 Score = 31.9 bits (69), Expect = 0.36 Identities = 12/50 (24%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +1 Query: 481 RCKGCGNPIVDKAIIALDAK-WHRDCFTCMKCRNPVTDSTFSVMENQPLC 627 +CK C + ++ L+ +H+ CF C C + +S M+ C Sbjct: 10 KCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVICNYSSMDGVLYC 59 Score = 28.3 bits (60), Expect = 4.5 Identities = 10/50 (20%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 481 RCKGCGNPIVDKAIIALDAK-WHRDCFTCMKCRNPVTDSTFSVMENQPLC 627 +C C + + ++ + +H+ CF C P+T S+++ ++ C Sbjct: 106 KCAACKKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHSSYAALDGVLYC 155 >At2g37810.1 68415.m04642 CHP-rich zinc finger protein, putative Length = 233 Score = 31.9 bits (69), Expect = 0.36 Identities = 21/69 (30%), Positives = 28/69 (40%), Gaps = 13/69 (18%) Frame = +1 Query: 130 CNSCDKVIQGRIVTA---LNKKWHPEH----FV------CNTCRKPIDGAKFHQHNNGVH 270 C CD V+ T L HP+H FV CN C + ++G +H G Sbjct: 45 CAPCDYVLHDHCATCPFTLISFMHPQHELRLFVNGSENMCNICHRLVEGVYYHCETCGFD 104 Query: 271 CVPCFTKHH 297 P T+HH Sbjct: 105 VHPLCTQHH 113 >At1g53450.2 68414.m06059 expressed protein Length = 453 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = -1 Query: 293 CLVKQGTQWTPLLCWWNLAPSIGLRQVLQTKCSG 192 C KQGT+ TP++ W + + ++G+ Q L + SG Sbjct: 326 CKSKQGTRITPMINWPDKSLALGVSQALAWRRSG 359 >At1g53450.1 68414.m06058 expressed protein Length = 453 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = -1 Query: 293 CLVKQGTQWTPLLCWWNLAPSIGLRQVLQTKCSG 192 C KQGT+ TP++ W + + ++G+ Q L + SG Sbjct: 326 CKSKQGTRITPMINWPDKSLALGVSQALAWRRSG 359 >At1g10200.1 68414.m01150 transcription factor LIM, putative strong similarity to transcription factor Ntlim1 [Nicotiana tabacum] GI:5689136, LIM domain protein WLIM-1 [Helianthus annuus] GI:5070280; contains Pfam profile PF00412: LIM domain Length = 190 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/56 (25%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +1 Query: 130 CNSCDKVIQ-GRIVTALNKKWHPEHFVCNTCRKPIDGAKFHQHNNGVHCVPCFTKH 294 C +CDK + +TA N+ +H F C+ C+ + + ++ ++C P F ++ Sbjct: 10 CMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHFDQN 65 Score = 28.3 bits (60), Expect = 4.5 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +1 Query: 481 RCKGCGNPI--VDKAIIALDAKWHRDCFTCMKCRNPVTDSTFSVMENQPLC 627 +C C + VDK + A + +H+ CF C C+ + S ++ E C Sbjct: 9 KCMACDKTVYLVDK-LTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYC 58 >At1g01780.1 68414.m00097 LIM domain-containing protein similar to PGPS/D1 [Petunia x hybrida] GI:4105772, LIM domain protein PLIM1 [Nicotiana tabacum] GI:5932418; contains Pfam profile PF00412: LIM domain Length = 205 Score = 30.3 bits (65), Expect = 1.1 Identities = 11/50 (22%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 481 RCKGCGNPIVDKAIIALDAK-WHRDCFTCMKCRNPVTDSTFSVMENQPLC 627 +C C + +++++ +H+ CF C C+ + S +S M+ C Sbjct: 9 KCNVCDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLQMSNYSSMDGVLYC 58 >At5g60250.1 68418.m07552 zinc finger (C3HC4-type RING finger) family protein contains a Prosite:PS00518 Zinc finger, C3HC4 type (RING finger), signature and Pfam domain PF01485: IBR domain Length = 655 Score = 29.5 bits (63), Expect = 1.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 484 CKGCGNPIVDKAIIALDAKWHRDCFTCMK 570 C C N IV + + ++D HR CF C+K Sbjct: 301 CAICFNDIVAEGMFSVDKCRHRFCFQCVK 329 >At2g39720.1 68415.m04874 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 401 Score = 29.5 bits (63), Expect = 1.9 Identities = 23/59 (38%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = +2 Query: 179 TRNGIPSTLSATPAVSQSMEPSSTSTTTVSIACPASPN--ITARGAMDAATPSLTV*SK 349 TR PS+ S+TP+ S + S T T SPN I RG+ AA PS V S+ Sbjct: 58 TRFPPPSSSSSTPSASMHADNSPTPTIVTRTRSNRSPNPVIVLRGS--AAAPSSDVVSE 114 >At2g32450.1 68415.m03964 calcium-binding EF hand family protein low similarity to O-linked GlcNAc transferase [Homo sapiens] GI:2266994; contains Pfam profiles PF00036: EF hand, PF00515: TPR Domain Length = 802 Score = 28.7 bits (61), Expect = 3.4 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +1 Query: 205 VCNTCRKPIDGAKFHQHNNGVH-CVPCFTKHHSP 303 VC+ CR PI G++F + G C C+++ P Sbjct: 730 VCSVCRYPIIGSRFKEVKTGFSLCNQCYSEGKIP 763 >At1g75080.2 68414.m08720 brassinosteroid signalling positive regulator (BZR1) identical to to BZR1 protein [Arabidopsis thaliana] gi|20270971|gb|AAM18490 Length = 336 Score = 28.7 bits (61), Expect = 3.4 Identities = 24/91 (26%), Positives = 41/91 (45%) Frame = +2 Query: 29 VRGFQNNTTQHESKKI*KQSPAQSCQQRLKPPPSVTAATK*FKAES*RR*TRNGIPSTLS 208 + G + T + S+ QSP S Q P V+ ++ F + S R N + ST Sbjct: 98 IAGTSSRVTPYSSQN---QSPLSSAFQSPIPSYQVSPSSSSFPSPS-RGEPNNNMSSTFF 153 Query: 209 ATPAVSQSMEPSSTSTTTVSIACPASPNITA 301 P + PSS + +S +CP +P +++ Sbjct: 154 --PFLRNGGIPSSLPSLRISNSCPVTPPVSS 182 >At1g75080.1 68414.m08719 brassinosteroid signalling positive regulator (BZR1) identical to to BZR1 protein [Arabidopsis thaliana] gi|20270971|gb|AAM18490 Length = 336 Score = 28.7 bits (61), Expect = 3.4 Identities = 24/91 (26%), Positives = 41/91 (45%) Frame = +2 Query: 29 VRGFQNNTTQHESKKI*KQSPAQSCQQRLKPPPSVTAATK*FKAES*RR*TRNGIPSTLS 208 + G + T + S+ QSP S Q P V+ ++ F + S R N + ST Sbjct: 98 IAGTSSRVTPYSSQN---QSPLSSAFQSPIPSYQVSPSSSSFPSPS-RGEPNNNMSSTFF 153 Query: 209 ATPAVSQSMEPSSTSTTTVSIACPASPNITA 301 P + PSS + +S +CP +P +++ Sbjct: 154 --PFLRNGGIPSSLPSLRISNSCPVTPPVSS 182 >At4g11270.1 68417.m01823 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); related to TGF-beta resistance-associated protein TRAG (GI:15624071) {Mus musculus}; similar to beta-transducin repeats containing protein - Homo sapiens,PID:e1284220; 3' EST no_NP:TC8031 Length = 1446 Score = 28.3 bits (60), Expect = 4.5 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -1 Query: 293 CLVKQGTQWTPLLCWWNLAPSIGLRQVLQTKCSG 192 C V+Q +QW P + W+L G + LQ K G Sbjct: 385 CDVEQPSQWRPHITIWSLCLGNGKEKELQRKVLG 418 >At3g61360.1 68416.m06866 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 498 Score = 28.3 bits (60), Expect = 4.5 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = -2 Query: 301 GCDVW*SRARNGHRCCAGGTWLHRLAYGRCCRQSARDAISCS 176 G D+W G+ C G L L C R+ A DA CS Sbjct: 406 GLDLWKYMLEKGY--CPHGHALELLTTALCARRRANDAFECS 445 >At2g02700.1 68415.m00210 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 499 Score = 28.3 bits (60), Expect = 4.5 Identities = 17/55 (30%), Positives = 23/55 (41%) Frame = +1 Query: 127 VCNSCDKVIQGRIVTALNKKWHPEHFVCNTCRKPIDGAKFHQHNNGVHCVPCFTK 291 VC CD ++ + A KK HP H PI+ H+ N+ C C K Sbjct: 393 VCVKCDFILHEKCADAPRKKVHPLH------PHPIEQKVVHE-NHEFECAACMRK 440 >At1g16190.1 68414.m01939 DNA repair protein RAD23, putative similar to DNA repair by nucleotide excision (NER) RAD23 protein, isoform II GI:1914685 from [Daucus carota] Length = 368 Score = 28.3 bits (60), Expect = 4.5 Identities = 14/39 (35%), Positives = 25/39 (64%) Frame = +2 Query: 206 SATPAVSQSMEPSSTSTTTVSIACPASPNITARGAMDAA 322 +A+ A S +P+ST+T+T+S A+P+ T A+ A+ Sbjct: 79 TASSAGPSSTQPTSTTTSTISSTTLAAPSTTQSIAVPAS 117 >At5g07350.1 68418.m00839 tudor domain-containing protein / nuclease family protein contains Pfam domains PF00567: Tudor domain and PF00565: Staphylococcal nuclease homologue Length = 991 Score = 27.9 bits (59), Expect = 5.9 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 4/54 (7%) Frame = -2 Query: 499 FRTPCSEWRTCLHSNRSNRDGQP----VP*TLHRQAPSCIHRRRSGERATIRQE 350 F +P +E R CL S RS + G P P R+A + +R G++ ++ E Sbjct: 402 FGSPAAERRVCLSSIRSPKMGNPRREEKPAPYAREAREFLRQRLIGKQVIVQME 455 >At2g39830.1 68415.m04892 LIM domain-containing protein contains Pfam profile PF00412: LIM domain Length = 503 Score = 27.9 bits (59), Expect = 5.9 Identities = 15/63 (23%), Positives = 29/63 (46%), Gaps = 4/63 (6%) Frame = +1 Query: 127 VCNSCDKVI-QGRIVTALNKKWHPEHFVCNTCRKPIDGAKFHQHNNGV---HCVPCFTKH 294 +C C+ I G + + +HPE F C++C I + ++ G+ C P + + Sbjct: 161 ICGGCNSDIGSGNYLGCMGTFFHPECFRCHSCGYAITEHEIPTNDAGLIEYRCHPFWNQK 220 Query: 295 HSP 303 + P Sbjct: 221 YCP 223 >At1g79510.2 68414.m09269 expressed protein Length = 275 Score = 27.9 bits (59), Expect = 5.9 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +2 Query: 245 STSTTTVSIACPASPNITAR-GAMDAATPS 331 +TS + ACPASPN T GAMD+ + S Sbjct: 217 ATSVLDMVTACPASPNPTFMFGAMDSYSSS 246 >At1g79510.1 68414.m09268 expressed protein Length = 275 Score = 27.9 bits (59), Expect = 5.9 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +2 Query: 245 STSTTTVSIACPASPNITAR-GAMDAATPS 331 +TS + ACPASPN T GAMD+ + S Sbjct: 217 ATSVLDMVTACPASPNPTFMFGAMDSYSSS 246 >At5g58430.1 68418.m07317 exocyst subunit EXO70 family protein leucine zipper-containing protein, Lycopersicon esculentum, PIR:S21495; contains Pfam domain PF03081: Exo70 exocyst complex subunit; similar to rexo70 (GI:2827160) {Rattus norvegicus} Length = 624 Score = 27.5 bits (58), Expect = 7.8 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 3 VRDAPSDKTYADFKITQHNTKVKKYKNNHRHNHVNK 110 V+D D I +HN KVK+Y N++ + NK Sbjct: 480 VKDGDLGLLLGDDWIRKHNVKVKQYHMNYQRSSWNK 515 >At4g18780.1 68417.m02774 cellulose synthase, catalytic subunit (IRX1) nearly identical to gi:12836997 Length = 985 Score = 27.5 bits (58), Expect = 7.8 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 7/72 (9%) Frame = +1 Query: 424 MEQAGRPYCSDCYAD-------KFATRCKGCGNPIVDKAIIALDAKWHRDCFTCMKCRNP 582 M ++ P C+ C + +F C C PI KA + + K R C++C NP Sbjct: 1 MMESRSPICNTCGEEIGVKSNGEFFVACHECSFPIC-KACLEYEFKEGRRI--CLRCGNP 57 Query: 583 VTDSTFSVMENQ 618 ++ F +E + Sbjct: 58 YDENVFDDVETK 69 >At3g29375.1 68416.m03690 XH domain-containing protein contains Pfam profile: PF03469: XH domain Length = 335 Score = 27.5 bits (58), Expect = 7.8 Identities = 28/80 (35%), Positives = 37/80 (46%), Gaps = 2/80 (2%) Frame = +2 Query: 191 IPSTLSATPAVSQSMEPSSTSTT-TVSIACPASPNI-TARGAMDAATPSLTV*SKLLAYR 364 I T SATP+ PSS ST + S+ +SP+I A G+ ++ PS A Sbjct: 42 INPTSSATPSFEFGTVPSSPSTAPSTSLLFGSSPSIFGATGSSPSSLPS-------SAST 94 Query: 365 GTLTTSSAVDARRSLAVEGS 424 T TSS + SL V S Sbjct: 95 TTHATSSVTTTQPSLGVASS 114 >At3g19070.1 68416.m02422 cell wall protein-related similar to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; Length = 346 Score = 27.5 bits (58), Expect = 7.8 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +2 Query: 212 TPAVSQSMEPSSTSTTTVSIACPASPNITARGAMDAATPSL 334 T +VS S +PSS+ST S P+S + R + PSL Sbjct: 150 TSSVSYSHQPSSSSTLATSSFFPSSMPYSVRPPDSSDRPSL 190 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,950,292 Number of Sequences: 28952 Number of extensions: 326835 Number of successful extensions: 1280 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 1184 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1271 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1295224128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -