BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10a22r (696 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC12B10.07 |acp1||F-actin capping protein alpha subunit|Schizo... 26 5.9 >SPAC12B10.07 |acp1||F-actin capping protein alpha subunit|Schizosaccharomyces pombe|chr 1|||Manual Length = 256 Score = 25.8 bits (54), Expect = 5.9 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = +2 Query: 557 VSINYNSK-YWNNGYSPLCLYVEKNIIVSGCNPIRV 661 VS YN K YWN + +C Y + G + IRV Sbjct: 141 VSSKYNPKNYWNGSWRCICNYNVSEKKLEGRSHIRV 176 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,534,136 Number of Sequences: 5004 Number of extensions: 47524 Number of successful extensions: 100 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -