BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10a22r (696 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 26 0.39 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 24 1.6 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 24 1.6 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 24 1.6 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 24 1.6 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 24 1.6 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 24 1.6 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 24 1.6 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 24 1.6 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 24 1.6 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 24 1.6 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 24 1.6 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 24 1.6 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 23 2.8 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 22 6.4 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 22 6.4 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 22 6.4 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 22 6.4 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 22 6.4 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 22 6.4 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 22 6.4 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 22 6.4 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 22 6.4 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 22 6.4 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 22 6.4 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 22 6.4 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 22 6.4 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 25.8 bits (54), Expect = 0.39 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +2 Query: 554 YVSINYNSKYWNNGYSPLCLYVEKNIIVSGCNPIRVLTNIF 676 Y + NYN+ +NN Y+ C + NII P+ V I+ Sbjct: 333 YNNNNYNNNNYNNNYNNNCKKLYYNIINIEQIPVPVPVPIY 373 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 557 VSINYNSKYWNNGYSPL 607 +S NYN +NN Y PL Sbjct: 85 LSNNYNYNNYNNNYKPL 101 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 557 VSINYNSKYWNNGYSPL 607 +S NYN +NN Y PL Sbjct: 85 LSNNYNYNNYNNNYKPL 101 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 557 VSINYNSKYWNNGYSPL 607 +S NYN +NN Y PL Sbjct: 85 LSNNYNYNNYNNNYKPL 101 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 557 VSINYNSKYWNNGYSPL 607 +S NYN +NN Y PL Sbjct: 85 LSNNYNYNNYNNNYKPL 101 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.8 bits (49), Expect = 1.6 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +2 Query: 560 SINYNSKYWNNGYSPLCLYVEKNIIVSGCNPIRVLTNIF 676 S NYN K +NN Y+ LY NII P+ V I+ Sbjct: 306 SNNYNYKNYNNNYNSKKLYY--NIINIEQIPVPVPVPIY 342 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 557 VSINYNSKYWNNGYSPL 607 +S NYN +NN Y PL Sbjct: 318 LSNNYNYNNYNNNYKPL 334 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 1.6 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +2 Query: 560 SINYNSKYWNNGYSPLCLYVEKNIIVSGCNPIRVLTNIF 676 S NYN K +NN Y+ LY NII P+ V I+ Sbjct: 317 SNNYNYKNYNNNYNSKKLYY--NIINIEQIPVPVPVPIY 353 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 557 VSINYNSKYWNNGYSPL 607 +S NYN +NN Y PL Sbjct: 318 LSNNYNYNNYNNNYKPL 334 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 557 VSINYNSKYWNNGYSPL 607 +S NYN +NN Y PL Sbjct: 318 LSNNYNYNNYNNNYKPL 334 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 557 VSINYNSKYWNNGYSPL 607 +S NYN +NN Y PL Sbjct: 318 LSNNYNYNNYNNNYKPL 334 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 557 VSINYNSKYWNNGYSPL 607 +S NYN +NN Y PL Sbjct: 318 LSNNYNYNNYNNNYKPL 334 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 557 VSINYNSKYWNNGYSPL 607 +S NYN +NN Y PL Sbjct: 307 LSNNYNYNNYNNNYKPL 323 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 23.0 bits (47), Expect = 2.8 Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -2 Query: 365 KYPNAKPYKNYFRKM*IKN-LLNV 297 KY N Y NY +K+ KN ++N+ Sbjct: 90 KYSNYNNYNNYNKKLYYKNYIINI 113 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 178 HIKIIKQTPCPVTLYY 225 +I I+Q P PV +YY Sbjct: 105 NINYIEQIPVPVPVYY 120 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 178 HIKIIKQTPCPVTLYY 225 +I I+Q P PV +YY Sbjct: 105 NINYIEQIPVPVPVYY 120 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 178 HIKIIKQTPCPVTLYY 225 +I I+Q P PV +YY Sbjct: 105 NINYIEQIPVPVPVYY 120 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 178 HIKIIKQTPCPVTLYY 225 +I I+Q P PV +YY Sbjct: 105 NINYIEQIPVPVPVYY 120 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 178 HIKIIKQTPCPVTLYY 225 +I I+Q P PV +YY Sbjct: 105 NINYIEQIPVPVPVYY 120 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 178 HIKIIKQTPCPVTLYY 225 +I I+Q P PV +YY Sbjct: 111 NINYIEQIPIPVPVYY 126 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 178 HIKIIKQTPCPVTLYY 225 +I I+Q P PV +YY Sbjct: 111 NINYIEQIPIPVPVYY 126 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 178 HIKIIKQTPCPVTLYY 225 +I I+Q P PV +YY Sbjct: 111 NINYIEQIPIPVPVYY 126 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 178 HIKIIKQTPCPVTLYY 225 +I I+Q P PV +YY Sbjct: 111 NINYIEQIPIPVPVYY 126 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 178 HIKIIKQTPCPVTLYY 225 +I I+Q P PV +YY Sbjct: 110 NINYIEQIPIPVPVYY 125 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 178 HIKIIKQTPCPVTLYY 225 +I I+Q P PV +YY Sbjct: 115 NINYIEQIPIPVPVYY 130 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 178 HIKIIKQTPCPVTLYY 225 +I I+Q P PV +YY Sbjct: 115 NINYIEQIPIPVPVYY 130 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 178 HIKIIKQTPCPVTLYY 225 +I I+Q P PV +YY Sbjct: 115 NINYIEQIPIPVPVYY 130 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,113 Number of Sequences: 438 Number of extensions: 3817 Number of successful extensions: 46 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -