BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10a18r (785 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC32H8.13c |mok12||alpha-1,3-glucan synthase Mok12|Schizosacch... 28 1.7 SPCC191.11 |inv1||beta-fructofuranosidase|Schizosaccharomyces po... 26 5.3 >SPBC32H8.13c |mok12||alpha-1,3-glucan synthase Mok12|Schizosaccharomyces pombe|chr 2|||Manual Length = 2352 Score = 27.9 bits (59), Expect = 1.7 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +3 Query: 690 ITWYILNNXFQLLPLDNIWFITPFG 764 + W +L + ++L L+N+WF FG Sbjct: 2190 VVWAVLLSVIKILSLNNVWFPVIFG 2214 >SPCC191.11 |inv1||beta-fructofuranosidase|Schizosaccharomyces pombe|chr 3|||Manual Length = 581 Score = 26.2 bits (55), Expect = 5.3 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +3 Query: 57 LHYNTKHFKQNKTLWDYECFIRVMNLINERNYLVLF 164 L N+ F+ K +WD++ VM + +NY + F Sbjct: 219 LDINSLQFRDPKVIWDFDANRWVMIVAMSQNYGIAF 254 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,868,525 Number of Sequences: 5004 Number of extensions: 52997 Number of successful extensions: 98 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 98 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 381366860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -