BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10a17f (610 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g34450.1 68415.m04227 high mobility group (HMG1/2) family pro... 31 0.60 At1g67650.1 68414.m07720 expressed protein 29 1.8 At1g60780.1 68414.m06842 clathrin adaptor complexes medium subun... 29 2.4 At1g05360.1 68414.m00543 expressed protein Similar to Arabidopsi... 29 2.4 At5g64740.1 68418.m08141 cellulose synthase, catalytic subunit, ... 29 3.2 At1g68990.1 68414.m07895 DNA-directed RNA polymerase, mitochondr... 29 3.2 At1g24490.1 68414.m03084 60 kDa inner membrane family protein si... 29 3.2 At1g02570.1 68414.m00208 expressed protein 29 3.2 At5g61580.1 68418.m07727 phosphofructokinase family protein simi... 28 5.6 At1g10270.1 68414.m01157 pentatricopeptide (PPR) repeat-containi... 28 5.6 At5g13840.1 68418.m01618 WD-40 repeat family protein contains 6 ... 27 7.4 At3g52030.1 68416.m05707 F-box family protein / WD-40 repeat fam... 27 7.4 At3g09030.1 68416.m01059 potassium channel tetramerisation domai... 27 7.4 At1g74800.1 68414.m08666 galactosyltransferase family protein co... 27 7.4 At1g28440.1 68414.m03496 leucine-rich repeat transmembrane prote... 27 7.4 At5g64950.1 68418.m08170 mitochondrial transcription termination... 27 9.7 At5g45470.1 68418.m05586 expressed protein contains Pfam domain,... 27 9.7 At5g09870.1 68418.m01141 cellulose synthase, catalytic subunit, ... 27 9.7 At4g37850.1 68417.m05354 basic helix-loop-helix (bHLH) family pr... 27 9.7 At1g15860.1 68414.m01903 expressed protein 27 9.7 >At2g34450.1 68415.m04227 high mobility group (HMG1/2) family protein similar to HMG protein [Arabidopsis thaliana] GI:2832361; contains Pfam profile PF00505: HMG (high mobility group) box Length = 151 Score = 31.1 bits (67), Expect = 0.60 Identities = 14/35 (40%), Positives = 24/35 (68%), Gaps = 3/35 (8%) Frame = +3 Query: 237 RFREDTPDIKALRE--KEKGD-WRKLTLEEKKTLY 332 +++E+ PD+K++RE K G+ W+ +T EEK Y Sbjct: 80 QYQEENPDVKSMREIGKTCGEKWKTMTYEEKVKYY 114 >At1g67650.1 68414.m07720 expressed protein Length = 651 Score = 29.5 bits (63), Expect = 1.8 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Frame = -2 Query: 516 SGAEP--SASLHSMSQE*DCTQRLSWPCRSKQPKMRGLEPNQRLPSTLRWGPGTQRRSDR 343 SGA+P S S+SQE +++ + K PK LE + P RW P +R S R Sbjct: 535 SGAKPIEGISAASLSQEEVKKEKVKRKRKPKYPKGFDLENSGPTPDPERWLPRRERSSYR 594 Query: 342 MK 337 K Sbjct: 595 PK 596 >At1g60780.1 68414.m06842 clathrin adaptor complexes medium subunit family protein contains Pfam profile: PF00928 adaptor complexes medium subunit family Length = 428 Score = 29.1 bits (62), Expect = 2.4 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +3 Query: 168 WVGYGFNGQPNYVDRPDFPLPAIRFREDTPDIKA 269 W F G Y+ R +F LP+I E TP+ KA Sbjct: 346 WKIKSFPGNKEYMLRAEFHLPSITAEEATPERKA 379 >At1g05360.1 68414.m00543 expressed protein Similar to Arabidopsis hypothetical protein PID:e326839 (gb|Z97337) contains transmembrane domains Length = 416 Score = 29.1 bits (62), Expect = 2.4 Identities = 22/65 (33%), Positives = 29/65 (44%), Gaps = 2/65 (3%) Frame = +3 Query: 237 RFREDTPDIKALREKEKGDWRKLTLEEK--KTLYRASFCQTFAEFQAPTGEWKGVVGWAL 410 R TP I LREK + D KLTL + KTL R F + + VGW + Sbjct: 6 RASSKTPAISGLREKHQQDLEKLTLTSQPFKTL-RLFVVAVFLYVRRWSSYLLANVGWLI 64 Query: 411 VLSSL 425 + S+ Sbjct: 65 LFCSI 69 >At5g64740.1 68418.m08141 cellulose synthase, catalytic subunit, putative similar to gi:2827141 cellulose synthase catalytic subunit (Ath-A), Arabidopsis thaliana Length = 1084 Score = 28.7 bits (61), Expect = 3.2 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +1 Query: 58 WPII*CAGRSSMLSVFLSAPGLDPLETLNLPRLVTVS 168 WP M+ VFL + G+ +E LPRLV VS Sbjct: 490 WPGNSVRDHPGMIQVFLGSDGVRDVENNELPRLVYVS 526 >At1g68990.1 68414.m07895 DNA-directed RNA polymerase, mitochondrial (RPOMT) identical to SP|P92969 DNA-directed RNA polymerase, mitochondrial precursor (EC 2.7.7.6) {Arabidopsis thaliana} Length = 976 Score = 28.7 bits (61), Expect = 3.2 Identities = 18/51 (35%), Positives = 23/51 (45%) Frame = +3 Query: 135 NTELAKIGDREWVGYGFNGQPNYVDRPDFPLPAIRFREDTPDIKALREKEK 287 N ++ + DR W G G VDR D P+P RED K R + K Sbjct: 468 NKKVLSLVDRIWANGGRIG--GLVDREDVPIPEEPEREDQEKFKNWRWESK 516 >At1g24490.1 68414.m03084 60 kDa inner membrane family protein similar to chloroplast membrane protein (ALBINO3) (GI:3927828) [Arabidopsis thaliana] Length = 1013 Score = 28.7 bits (61), Expect = 3.2 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +3 Query: 231 AIRFREDTPDIKALREKEKGDWRKLTLEEKKTLYR 335 A+ + TP IKA++E+ GD K+ LE + LY+ Sbjct: 666 AMAMKSLTPQIKAIQERYAGDQEKIQLETAR-LYK 699 >At1g02570.1 68414.m00208 expressed protein Length = 431 Score = 28.7 bits (61), Expect = 3.2 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = -3 Query: 218 VRPVYVVGLAVETIAYPLTVTNLGKFSVSSGSSP 117 VRP ++ +++ ++ PL+ L + SVSS S+P Sbjct: 17 VRPFQMISISLLSLLVPLSFLFLSRLSVSSSSAP 50 >At5g61580.1 68418.m07727 phosphofructokinase family protein similar to phosphofructokinase [Amycolatopsis methanolica] GI:17432243; contains Pfam profile PF00365: Phosphofructokinase Length = 530 Score = 27.9 bits (59), Expect = 5.6 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 183 FNGQPNYVDRPDFPLPAIRFREDTPDIKALREK 281 FN N + R DFPLPA++ ++ + + L +K Sbjct: 18 FNPSSNVLPRRDFPLPALKLKKVSVLPRILHQK 50 >At1g10270.1 68414.m01157 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile: PF01535 PPR repeat; similar to ESTs gb|R30192 and gb|AA651017 Length = 913 Score = 27.9 bits (59), Expect = 5.6 Identities = 17/45 (37%), Positives = 21/45 (46%) Frame = -2 Query: 231 QAGGSQACLRSWAGR*NHSLPTHGHQSWQVQCFQWIQPWRRQEHG 97 QA G Q +SW+ + S P+ QSW Q QPW Q G Sbjct: 701 QAPGYQQ-QQSWSQQSGWSSPSGHQQSWTNQTAGQQQPWANQTPG 744 >At5g13840.1 68418.m01618 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to Fzr1 (GI:6463679){Homo sapiens} Length = 481 Score = 27.5 bits (58), Expect = 7.4 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -2 Query: 222 GSQACLRSWAGR*NHSLPTHGHQSWQVQCFQW 127 GSQ C +W+ N + THG+ Q+ +++ Sbjct: 384 GSQVCNLAWSKNVNEIVSTHGYSQNQIMLWKY 415 >At3g52030.1 68416.m05707 F-box family protein / WD-40 repeat family protein Length = 454 Score = 27.5 bits (58), Expect = 7.4 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = -3 Query: 155 NLGKFSVSSGSSPGADRNTDSIDERPAHQIIGHFAGRIGLELYENHTHQ 9 +LG S SS +S D D H + GRI +E +E H+H+ Sbjct: 72 HLGSDSPSSSTSLDRPAEIDVEDFAMKHHKMALLRGRIEIERWEAHSHR 120 >At3g09030.1 68416.m01059 potassium channel tetramerisation domain-containing protein contains Pfam profile PF02214: K+ channel tetramerisation domain Length = 460 Score = 27.5 bits (58), Expect = 7.4 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +3 Query: 90 NAIRVPVCARAGSTGNTELAKIGDREWV 173 ++I VC+++G G ++ K+G+ WV Sbjct: 330 DSILFKVCSKSGDLGMADIRKLGEDPWV 357 >At1g74800.1 68414.m08666 galactosyltransferase family protein contains Pfam profile: PF01762 galactosyltransferase Length = 672 Score = 27.5 bits (58), Expect = 7.4 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 246 EDTPDIKALREKEKGDWRKLTLEEKKTLYR 335 ED P I + KGDW K + E+ + YR Sbjct: 241 EDPPRILHFNPRLKGDWSKKPVIEQNSCYR 270 >At1g28440.1 68414.m03496 leucine-rich repeat transmembrane protein kinase, putative similar to receptor kinase GI:4105699 from [Arabidopsis thaliana] Length = 996 Score = 27.5 bits (58), Expect = 7.4 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +1 Query: 25 SYNSSPILPAKWPII*CAGR-SSMLSVFLSAPGL 123 S+NS+ P +W + CAG SS+ SV LS+ L Sbjct: 39 SWNSNDASPCRWSGVSCAGDFSSVTSVDLSSANL 72 >At5g64950.1 68418.m08170 mitochondrial transcription termination factor-related / mTERF-related contains Pfam profile PF02536: mTERF Length = 391 Score = 27.1 bits (57), Expect = 9.7 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = -1 Query: 544 MGFTLRSNILWS*AFCLSSLNESGIGLYTKTFMA 443 +GFTL S +L LSSL+E K FMA Sbjct: 226 LGFTLNSRMLVHAVISLSSLSEKTFDRKVKLFMA 259 >At5g45470.1 68418.m05586 expressed protein contains Pfam domain, PF04578: Protein of unknown function, DUF594 Length = 866 Score = 27.1 bits (57), Expect = 9.7 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -2 Query: 156 QSWQVQCFQWIQPWRR 109 QSWQ +CF W+ +R+ Sbjct: 383 QSWQERCFNWLLKFRK 398 >At5g09870.1 68418.m01141 cellulose synthase, catalytic subunit, putative similar to gi:2827141 cellulose synthase catalytic subunit (Ath-A), Arabidopsis thaliana Length = 1069 Score = 27.1 bits (57), Expect = 9.7 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +1 Query: 58 WPII*CAGRSSMLSVFLSAPGLDPLETLNLPRLVTVS 168 WP M+ VFL G+ +E LPRLV VS Sbjct: 478 WPGNNVRDHPGMIQVFLGNNGVRDVENNELPRLVYVS 514 >At4g37850.1 68417.m05354 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 328 Score = 27.1 bits (57), Expect = 9.7 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 216 DFPLPAIRFREDTPDIKALREKEKGDWRKLTLEEKK 323 D P +RF ++ IK L EK+KG K+ E +K Sbjct: 245 DLPEIEVRFSDEDVLIKILCEKQKGHLAKIMAEIEK 280 >At1g15860.1 68414.m01903 expressed protein Length = 225 Score = 27.1 bits (57), Expect = 9.7 Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +3 Query: 279 KEKGDWRKLTLEEKKTLYRASFCQTFAEFQAPT-GEWKGVVGWALVLSSLAAWI 437 K + D++ + +++ LYR FC E P G++ + W L+L + WI Sbjct: 172 KIQNDYKVINMDQWMGLYR--FCN---EISFPDMGDYNPELAWPLILDNFVEWI 220 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,826,874 Number of Sequences: 28952 Number of extensions: 337286 Number of successful extensions: 915 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 901 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 915 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1216725696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -