BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10a16r (689 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC4B3.17 |cbp3||ubiquinol cytochrome-c reductase assembly prot... 28 1.5 SPBC16C6.01c ||SPBC543.11c|lysine methyltransferase |Schizosacch... 27 3.4 SPCC306.11 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||... 26 5.9 SPBC32H8.01c ||SPBP22H7.10c|conserved fungal protein|Schizosacch... 25 7.8 SPCC594.01 ||SPCC736.16|DUF1769 family protein|Schizosaccharomyc... 25 7.8 >SPCC4B3.17 |cbp3||ubiquinol cytochrome-c reductase assembly protein Cbp3|Schizosaccharomyces pombe|chr 3|||Manual Length = 283 Score = 27.9 bits (59), Expect = 1.5 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 480 WHYRCPHPRRFLEWFCLHTLHYEASHT 560 W+ +C P F WF + LH HT Sbjct: 126 WYQKCEIPMTFQSWFQITQLHLWILHT 152 >SPBC16C6.01c ||SPBC543.11c|lysine methyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 473 Score = 26.6 bits (56), Expect = 3.4 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -3 Query: 402 TLCAQTGSDSVLIAHENCDKFYICWNHKPVVLSCPPNLLYNPS 274 T C D +IA+E FY+ W HK +++ LL P+ Sbjct: 270 TACKVWRVDMTMIAYETNRNFYMEWIHKKRIIN-TQELLVTPT 311 >SPCC306.11 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 283 Score = 25.8 bits (54), Expect = 5.9 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -3 Query: 348 DKFYICWNHKPVVLSCPPNLLY 283 D IC NH V+L+CP L Y Sbjct: 83 DVIAICANHSTVLLNCPTVLGY 104 >SPBC32H8.01c ||SPBP22H7.10c|conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 187 Score = 25.4 bits (53), Expect = 7.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 372 VLIAHENCDKFYICWNH 322 VLI D FY+C+NH Sbjct: 38 VLITKTKLDFFYVCYNH 54 >SPCC594.01 ||SPCC736.16|DUF1769 family protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 791 Score = 25.4 bits (53), Expect = 7.8 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = -3 Query: 684 ENDSDXVLVAHEHCTRFYKCFN--SRPVALICPPNL 583 E+D D L+ H H T +K FN + + L+ P+L Sbjct: 303 EDDEDDELLLHRHITNKHKDFNLHVKQLGLLHKPSL 338 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,612,323 Number of Sequences: 5004 Number of extensions: 53154 Number of successful extensions: 157 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 157 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 319939482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -