BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10a16f (781 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_03_0285 - 14604499-14604608,14604692-14605203,14605339-146054... 31 1.0 01_06_1801 - 39954425-39954533,39955289-39955578,39955786-399568... 29 5.5 >01_03_0285 - 14604499-14604608,14604692-14605203,14605339-14605418, 14605597-14605699,14605759-14605907,14606088-14606180, 14606289-14606675,14607690-14608124,14608198-14608311, 14608405-14608453,14608684-14608843,14608941-14609499 Length = 916 Score = 31.1 bits (67), Expect = 1.0 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 473 AEKDSDGVLVAHEHCTRFYKCFDSHPVALI 562 +EKD DGV+ H HC+ Y+ D+ ++ Sbjct: 806 SEKDKDGVIELHNHCSSVYQEGDARSALIV 835 >01_06_1801 - 39954425-39954533,39955289-39955578,39955786-39956838, 39956998-39957263,39957345-39957420,39957525-39957605, 39957676-39957831,39958565-39958669,39958761-39959367, 39959514-39959585,39959802-39959953,39960063-39960240, 39960642-39960745,39960822-39960953,39961036-39961132, 39961280-39961407,39961533-39961592,39962799-39962918, 39963011-39963091,39963173-39963361,39963826-39964024, 39964177-39964257,39964398-39964588,39965226-39965382, 39965986-39966119,39966266-39966334,39966434-39966481, 39966572-39966646,39967112-39967192,39967399-39967461, 39967564-39967623,39967754-39967795,39968777-39968902, 39969027-39969176 Length = 1843 Score = 28.7 bits (61), Expect = 5.5 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Frame = -1 Query: 730 RVHFQCYRFVSVSSTAIVTFTINILVVFWNDSVSTLYIMRPVALLVIRIIQQIWRTNEG- 554 R H ++V STA+ T L+ D ++ +I VA L+ R + +++++ G Sbjct: 815 RCHGILLQYVEFLSTAVTPTTYVQLIPPLEDLINKYHIEPDVAFLIYRPVMRLFKSTNGG 874 Query: 553 --YW 548 YW Sbjct: 875 DTYW 878 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,585,176 Number of Sequences: 37544 Number of extensions: 320797 Number of successful extensions: 762 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 712 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 762 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2091906552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -