BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10a15r (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 27 0.076 DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase rever... 23 1.6 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.7 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 21 8.7 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 21 8.7 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 27.5 bits (58), Expect = 0.076 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = +3 Query: 369 PRSYRGSTRRLRHFYSNVVKLYFKSD---IHLARL 464 P+SY G+T L+ FY V K+ +S IHL+ L Sbjct: 57 PKSYFGTTTNLKRFYKVVEKILTQSSFECIHLSVL 91 >DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase reverse transcriptase protein. Length = 73 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 369 PRSYRGSTRRLRHFY 413 P+SY G+T L+ FY Sbjct: 57 PKSYFGTTTNLKRFY 71 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 8.7 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +2 Query: 308 DGLYYHWLFVGQQKL 352 DG+ HW + G +K+ Sbjct: 291 DGMDIHWEYPGAEKM 305 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 20.6 bits (41), Expect = 8.7 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +3 Query: 384 GSTRRLRHFYSNVVKLYFKSDIH 452 G RRLR Y+N L + + H Sbjct: 2 GLPRRLRTAYTNTQLLELEKEFH 24 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 20.6 bits (41), Expect = 8.7 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +3 Query: 384 GSTRRLRHFYSNVVKLYFKSDIH 452 G RRLR Y+N L + + H Sbjct: 133 GLPRRLRTAYTNTQLLELEKEFH 155 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,044 Number of Sequences: 336 Number of extensions: 2136 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -