BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10a15r (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC025715-6|AAK68450.1| 81|Caenorhabditis elegans Hypothetical ... 62 2e-10 Z83105-1|CAB05480.1| 335|Caenorhabditis elegans Hypothetical pr... 31 0.66 >AC025715-6|AAK68450.1| 81|Caenorhabditis elegans Hypothetical protein Y38F2AR.9 protein. Length = 81 Score = 62.1 bits (144), Expect = 2e-10 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -1 Query: 251 SGGMWRFYTDDSXXXXXXXXXXXVMSLLFIASVFMLHIWGKYTRA 117 +GG+WRFYT+DS VMSL+FIASVF+LHIWGK+TR+ Sbjct: 35 NGGLWRFYTEDSTGLKIGPVPVLVMSLVFIASVFVLHIWGKFTRS 79 >Z83105-1|CAB05480.1| 335|Caenorhabditis elegans Hypothetical protein F14H3.1 protein. Length = 335 Score = 30.7 bits (66), Expect = 0.66 Identities = 21/68 (30%), Positives = 29/68 (42%), Gaps = 5/68 (7%) Frame = +2 Query: 227 YRTSTFLQNQHQCFGFWLQL***LIFVD-GLYY----HWLFVGQQKLLWVIYSQILQR*H 391 YR S F Q HQ GFW L + + G+ + L G QK+ IY Q ++ H Sbjct: 112 YRYSVFTQISHQKLGFWALLGLFIFLISHGIVWSSVCELLLYGDQKVADYIYKQFMKDYH 171 Query: 392 SEIEAFLF 415 + F Sbjct: 172 VDSHGLFF 179 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,356,246 Number of Sequences: 27780 Number of extensions: 187315 Number of successful extensions: 327 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 321 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 327 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -