BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10a14r (721 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 50 7e-08 AF164153-1|AAD47077.1| 131|Anopheles gambiae ribosomal protein ... 25 2.4 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 23 7.2 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 23 9.5 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 23 9.5 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 50.0 bits (114), Expect = 7e-08 Identities = 19/35 (54%), Positives = 29/35 (82%) Frame = -1 Query: 685 ECEDIASEYNINSMPTFVFVKNGKKLDEFSGANVD 581 ECE++A++YNI SMPTF+F+K + + +FSGAN + Sbjct: 62 ECEELAAQYNIASMPTFLFIKRKEVVGQFSGANAE 96 >AF164153-1|AAD47077.1| 131|Anopheles gambiae ribosomal protein S17 protein. Length = 131 Score = 25.0 bits (52), Expect = 2.4 Identities = 19/67 (28%), Positives = 33/67 (49%) Frame = +3 Query: 114 IKKKNIVILVTYKSF*KHDGNLSYTLISIGEIIHLSKPDKNKNKNITIHTLKFLSNHLVK 293 IKK + VI+ Y + D + + ++ II +KP +NK H +K L + V+ Sbjct: 9 IKKASKVIIEKYYTRLTMDFDTNKRIVEEVAIIP-TKPLRNKIAGFVTHLMKRLRHSQVR 67 Query: 294 KTKIEIQ 314 I++Q Sbjct: 68 GISIKLQ 74 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 23.4 bits (48), Expect = 7.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -2 Query: 162 FKNFCK*QVSQCFFFLCYASRS 97 F+ FC +V+ FF CYA S Sbjct: 69 FEGFCIAEVNGVFFCSCYAPPS 90 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +3 Query: 537 LVSIYLCLRIVVLSLSTLAPE 599 LVSI +C+ +VVL++ +P+ Sbjct: 316 LVSISICVTVVVLNVHFRSPQ 336 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +3 Query: 537 LVSIYLCLRIVVLSLSTLAPE 599 LVSI +C+ +VVL++ +P+ Sbjct: 316 LVSISICVTVVVLNVHFRSPQ 336 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 686,367 Number of Sequences: 2352 Number of extensions: 13286 Number of successful extensions: 26 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -