BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10a14f (486 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 71 3e-13 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 69 2e-12 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 68 4e-12 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 68 4e-12 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 66 9e-12 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 64 5e-11 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 64 6e-11 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 64 6e-11 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 62 1e-10 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 62 3e-10 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 61 3e-10 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 61 4e-10 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 61 4e-10 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 58 3e-09 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 58 3e-09 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 54 4e-08 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 53 9e-08 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 51 4e-07 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 50 8e-07 At2g40790.1 68415.m05032 thioredoxin family protein contains Pfa... 49 2e-06 At2g35010.1 68415.m04295 thioredoxin family protein similar to S... 47 8e-06 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 46 1e-05 At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa... 46 2e-05 At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa... 46 2e-05 At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thiore... 45 3e-05 At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa... 45 3e-05 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 44 7e-05 At3g56420.1 68416.m06275 thioredoxin family protein similar to t... 44 7e-05 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 43 1e-04 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 42 2e-04 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 42 3e-04 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 41 5e-04 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 41 5e-04 At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 40 9e-04 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 40 9e-04 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 40 0.001 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 39 0.002 At5g04260.1 68418.m00417 thioredoxin family protein low similari... 38 0.004 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 38 0.005 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 38 0.005 At5g06690.1 68418.m00756 thioredoxin family protein low similiar... 38 0.005 At4g04950.1 68417.m00719 thioredoxin family protein similar to P... 38 0.005 At1g76080.1 68414.m08835 thioredoxin family protein low similari... 37 0.006 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 37 0.006 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 37 0.006 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 37 0.006 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 37 0.008 At3g53220.1 68416.m05864 thioredoxin family protein low similari... 37 0.008 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 36 0.011 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 36 0.011 At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa... 36 0.014 At1g60420.1 68414.m06802 DC1 domain-containing protein contains ... 34 0.044 At5g60620.1 68418.m07608 phospholipid/glycerol acyltransferase f... 34 0.058 At1g07700.3 68414.m00829 thioredoxin family protein low similari... 33 0.077 At1g07700.1 68414.m00828 thioredoxin family protein low similari... 33 0.077 At3g03860.1 68416.m00398 expressed protein 32 0.18 At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH... 32 0.24 At1g07700.2 68414.m00827 thioredoxin family protein low similari... 29 1.7 At4g31240.2 68417.m04435 expressed protein 28 3.8 At4g31240.1 68417.m04434 expressed protein 28 3.8 At2g29040.1 68415.m03530 exostosin family protein contains Pfam ... 28 3.8 At1g78740.1 68414.m09177 hypothetical protein 27 5.1 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 27 5.1 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 71.3 bits (167), Expect = 3e-13 Identities = 32/91 (35%), Positives = 50/91 (54%) Frame = +2 Query: 116 HIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXX 295 H D ++ A+ +KL+VIDF A+WC PC+MI P +++A + Sbjct: 12 HTNDVWTVQLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFKVDVDEL 71 Query: 296 XXXASEYNINSMPTFVFVKNGKKLDEFSGAN 388 A E+ + +MPTFVF+K G+ +D+ GAN Sbjct: 72 QSVAKEFGVEAMPTFVFIKAGEVVDKLVGAN 102 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 68.9 bits (161), Expect = 2e-12 Identities = 35/96 (36%), Positives = 54/96 (56%), Gaps = 2/96 (2%) Frame = +2 Query: 113 IHIKDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXX 286 + IK+ + K+RL D KL+VI+F A WCGPCK + PKL+E+AA+ Sbjct: 40 VEIKNMNQWKSRLNALKDTNKLLVIEFTAKWCGPCKTLEPKLEELAAKYTDVEFVKIDVD 99 Query: 287 XXXXXXASEYNINSMPTFVFVKNGKKLDEFSGANVD 394 E+N++++P VF+K G+++D G VD Sbjct: 100 VLMSVW-MEFNLSTLPAIVFMKRGREVDMVVGVKVD 134 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 67.7 bits (158), Expect = 4e-12 Identities = 31/94 (32%), Positives = 53/94 (56%) Frame = +2 Query: 107 MSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXX 286 +SIH + KT+ A+ +L+++ F ATWCGPC+ + P +A + Sbjct: 273 ISIHSTSELEAKTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHSRVVFLKVDID 332 Query: 287 XXXXXXASEYNINSMPTFVFVKNGKKLDEFSGAN 388 AS +NI+S+PTF F+++GK++D+ GA+ Sbjct: 333 KANDVAAS-WNISSVPTFCFIRDGKEVDKVVGAD 365 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 67.7 bits (158), Expect = 4e-12 Identities = 29/79 (36%), Positives = 45/79 (56%) Frame = +2 Query: 149 LAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINS 328 L + DK V++DF ATWCGPC+++ P L+E++ + A++Y I + Sbjct: 71 LLQNSDKPVLVDFYATWCGPCQLMVPILNEVSETLKDIIAVVKIDTEKYPSLANKYQIEA 130 Query: 329 MPTFVFVKNGKKLDEFSGA 385 +PTF+ K+GK D F GA Sbjct: 131 LPTFILFKDGKLWDRFEGA 149 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 66.5 bits (155), Expect = 9e-12 Identities = 30/77 (38%), Positives = 44/77 (57%) Frame = +2 Query: 164 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 343 +KL+V+DF A+WCGPC+MI P + + A+ A E+N+ +MPTFV Sbjct: 47 NKLLVVDFSASWCGPCRMIEPAIHAM-ADKFNDVDFVKLDVDELPDVAKEFNVTAMPTFV 105 Query: 344 FVKNGKKLDEFSGANVD 394 VK GK+++ GA D Sbjct: 106 LVKRGKEIERIIGAKKD 122 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 64.1 bits (149), Expect = 5e-11 Identities = 33/92 (35%), Positives = 50/92 (54%) Frame = +2 Query: 113 IHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXX 292 I K+S D K A+ K+VV +F ATWCGPCK++ P E+ +E Sbjct: 28 ITTKESWDDKLAEADRDGKIVVANFSATWCGPCKIVAPFFIEL-SEKHSSLMFLLVDVDE 86 Query: 293 XXXXASEYNINSMPTFVFVKNGKKLDEFSGAN 388 +S ++I + PTF F+KNG+++ + GAN Sbjct: 87 LSDFSSSWDIKATPTFFFLKNGQQIGKLVGAN 118 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 63.7 bits (148), Expect = 6e-11 Identities = 32/96 (33%), Positives = 52/96 (54%) Frame = +2 Query: 107 MSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXX 286 ++ H ++ + + + A LVV+DF A+WCGPC+ I P ++A ++ Sbjct: 9 IACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKL-PNVLFLKVDT 67 Query: 287 XXXXXXASEYNINSMPTFVFVKNGKKLDEFSGANVD 394 AS++ I +MPTF+F+K GK LD+ GA D Sbjct: 68 DELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKD 103 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 63.7 bits (148), Expect = 6e-11 Identities = 26/74 (35%), Positives = 42/74 (56%) Frame = +2 Query: 164 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 343 DK V++D+ ATWCGPC+ + P L+E++ + A++Y I ++PTF+ Sbjct: 81 DKPVLVDYYATWCGPCQFMVPILNEVSETLKDKIQVVKIDTEKYPSIANKYKIEALPTFI 140 Query: 344 FVKNGKKLDEFSGA 385 K+G+ D F GA Sbjct: 141 LFKDGEPCDRFEGA 154 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 62.5 bits (145), Expect = 1e-10 Identities = 30/90 (33%), Positives = 43/90 (47%) Frame = +2 Query: 125 DSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXX 304 D D + AGDK+VV+D WCGPCK+I PK E++ + Sbjct: 84 DKDTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKYKELSEKYQDMVFLKLDCNQDNKPL 143 Query: 305 ASEYNINSMPTFVFVKNGKKLDEFSGANVD 394 A E I +PTF +K+ K + E +GA + Sbjct: 144 AKELGIRVVPTFKILKDNKVVKEVTGAKYE 173 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 61.7 bits (143), Expect = 3e-10 Identities = 30/80 (37%), Positives = 43/80 (53%) Frame = +2 Query: 155 EAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMP 334 + +KL+VIDF A WCGPCK + P++ EIA++ A Y ++P Sbjct: 40 KGSNKLLVIDFTAVWCGPCKAMEPRVREIASK-YSEAVFARVDVDRLMDVAGTYRAITLP 98 Query: 335 TFVFVKNGKKLDEFSGANVD 394 FVFVK G+++D GA D Sbjct: 99 AFVFVKRGEEIDRVVGAKPD 118 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 61.3 bits (142), Expect = 3e-10 Identities = 31/85 (36%), Positives = 42/85 (49%) Frame = +2 Query: 140 KTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYN 319 K + A KL+VIDF A+WC PC+ I P E+A + A E+ Sbjct: 19 KVKDANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKF-TNVVFFKIDVDELQAVAQEFK 77 Query: 320 INSMPTFVFVKNGKKLDEFSGANVD 394 + +MPTFVF+K G +D GA D Sbjct: 78 VEAMPTFVFMKEGNIIDRVVGAAKD 102 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 60.9 bits (141), Expect = 4e-10 Identities = 30/90 (33%), Positives = 49/90 (54%) Frame = +2 Query: 116 HIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXX 295 ++ DS+ +T++ E+ D V+++F A WCGPC+MI P +D++A + Sbjct: 90 NLSDSE-WQTKVLES-DVPVLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDES 147 Query: 296 XXXASEYNINSMPTFVFVKNGKKLDEFSGA 385 A+ Y I S+PT + K G+K D GA Sbjct: 148 PNTANRYGIRSVPTVIIFKGGEKKDSIIGA 177 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 60.9 bits (141), Expect = 4e-10 Identities = 30/90 (33%), Positives = 42/90 (46%) Frame = +2 Query: 125 DSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXX 304 D D + AG+KLVV+D WCGPCK+I PK ++ + Sbjct: 74 DKDTFWPIVKAAGEKLVVLDMYTQWCGPCKVIAPKYKALSEKYDDVVFLKLDCNPDNRPL 133 Query: 305 ASEYNINSMPTFVFVKNGKKLDEFSGANVD 394 A E I +PTF +K+ K + E +GA D Sbjct: 134 AKELGIRVVPTFKILKDNKVVKEVTGAKYD 163 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 58.0 bits (134), Expect = 3e-09 Identities = 28/82 (34%), Positives = 41/82 (50%) Frame = +2 Query: 140 KTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYN 319 K + A KL+VIDF ATWC PC+ I P ++ A+ A E+ Sbjct: 19 KLKAANESKKLIVIDFTATWCPPCRFIAPVFADL-AKKHLDVVFFKVDVDELNTVAEEFK 77 Query: 320 INSMPTFVFVKNGKKLDEFSGA 385 + +MPTF+F+K G+ + GA Sbjct: 78 VQAMPTFIFMKEGEIKETVVGA 99 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 58.0 bits (134), Expect = 3e-09 Identities = 28/86 (32%), Positives = 40/86 (46%) Frame = +2 Query: 128 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA 307 +D L D+ V +DF A WCGPCKMI P ++E+A + Sbjct: 80 NDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDPIVNELAQKYAGQFKFYKLNTDESPATP 139 Query: 308 SEYNINSMPTFVFVKNGKKLDEFSGA 385 +Y + S+PT + NG+K D GA Sbjct: 140 GQYGVRSIPTIMIFVNGEKKDTIIGA 165 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 54.4 bits (125), Expect = 4e-08 Identities = 24/71 (33%), Positives = 34/71 (47%) Frame = +2 Query: 173 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 352 VV+DF A WCGPCKMI P ++++A +Y + S+PT + Sbjct: 101 VVVDFWAPWCGPCKMIDPLVNDLAQHYTGKIKFYKLNTDESPNTPGQYGVRSIPTIMIFV 160 Query: 353 NGKKLDEFSGA 385 G+K D GA Sbjct: 161 GGEKKDTIIGA 171 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 53.2 bits (122), Expect = 9e-08 Identities = 22/70 (31%), Positives = 35/70 (50%) Frame = +2 Query: 173 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 352 V+++F +WCGPC+M+ +DEIA + A EY I ++P + K Sbjct: 87 VLVEFYTSWCGPCRMVHRIIDEIAGDYAGKLNCYLLNADNDLPVAEEYEIKAVPVVLLFK 146 Query: 353 NGKKLDEFSG 382 NG+K + G Sbjct: 147 NGEKRESIMG 156 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 51.2 bits (117), Expect = 4e-07 Identities = 19/65 (29%), Positives = 36/65 (55%) Frame = +2 Query: 173 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 352 V+++F+ATWCGPCK+I P ++ ++ E +E+ + +P F+ K Sbjct: 90 VLVEFVATWCGPCKLIYPAMEALSQEYGDKLTIVKIDHDANPKLIAEFKVYGLPHFILFK 149 Query: 353 NGKKL 367 +GK++ Sbjct: 150 DGKEV 154 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 50.0 bits (114), Expect = 8e-07 Identities = 22/50 (44%), Positives = 31/50 (62%) Frame = +2 Query: 101 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAE 250 P M I I ++ L +AGD+LV++DF TWCG C+ + PKL + A E Sbjct: 93 PNM-IDITSAEQFLNALKDAGDRLVIVDFYGTWCGSCRAMFPKLCKTAKE 141 >At2g40790.1 68415.m05032 thioredoxin family protein contains Pfam profile: PF00085 thioredoxin Length = 154 Score = 48.8 bits (111), Expect = 2e-06 Identities = 27/101 (26%), Positives = 52/101 (51%), Gaps = 3/101 (2%) Frame = +2 Query: 95 YLPKMSIH-IKDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXX 265 Y K +H + + + ++ EA K++V++F A+WC P K I P E+A+ Sbjct: 36 YFIKGKVHPVSRMEKWEEKITEANSHGKILVVNFKASWCLPSKTILPIYQELAS-TYTSM 94 Query: 266 XXXXXXXXXXXXXASEYNINSMPTFVFVKNGKKLDEFSGAN 388 + E+N+++ PT VF+K+G+++D+ G + Sbjct: 95 IFVTIDVEELAEFSHEWNVDATPTVVFLKDGRQMDKLVGGD 135 >At2g35010.1 68415.m04295 thioredoxin family protein similar to SP|Q42443 Thioredoxin H-type (TRX-H) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 194 Score = 46.8 bits (106), Expect = 8e-06 Identities = 27/94 (28%), Positives = 43/94 (45%), Gaps = 3/94 (3%) Frame = +2 Query: 119 IKDSDDLKTRLAEAGDKLV--VIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXX 292 +K ++ +++A D + V F A WCGPC+ I P + E++ + Sbjct: 89 VKSEEEFINAMSKAQDGSLPSVFYFTAAWCGPCRFISPVIVELSKQYPDVTTYKVDIDEG 148 Query: 293 XXXXA-SEYNINSMPTFVFVKNGKKLDEFSGANV 391 S+ NI ++PT F K G K E GA+V Sbjct: 149 GISNTISKLNITAVPTLHFFKGGSKKGEVVGADV 182 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 46.4 bits (105), Expect = 1e-05 Identities = 29/91 (31%), Positives = 40/91 (43%), Gaps = 1/91 (1%) Frame = +2 Query: 119 IKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXX 298 + DL L AGDKLVV+DF + CG CK + PK+ +I AE Sbjct: 98 VTSPQDLVVSLRNAGDKLVVVDFFSPSCGGCKALHPKICKI-AEKNPEVEFLQVNYEEHR 156 Query: 299 XXASEYNINSMPTFVFVKNGK-KLDEFSGAN 388 NI+ +P F F + ++ FS N Sbjct: 157 SLCQSLNIHVLPFFRFYRGSSGRVCSFSCTN 187 >At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 236 Score = 45.6 bits (103), Expect = 2e-05 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 1/94 (1%) Frame = +2 Query: 101 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXX 280 P M + I +++ + L+ AG++LV+++F TWC C+ + PKL + A E Sbjct: 103 PNM-VDIHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPDIVFLKVN 161 Query: 281 XXXXXXXXASEYNINSMPTFVFVKNGK-KLDEFS 379 S N+ +P F F + +L+ FS Sbjct: 162 FDENKPMCKS-LNVRVLPFFHFYRGADGQLESFS 194 >At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 235 Score = 45.6 bits (103), Expect = 2e-05 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 1/94 (1%) Frame = +2 Query: 101 PKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXX 280 P M + I +++ + L+ AG++LV+++F TWC C+ + PKL + A E Sbjct: 103 PNM-VDIHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVEHPDIVFLKVN 161 Query: 281 XXXXXXXXASEYNINSMPTFVFVKNGK-KLDEFS 379 S N+ +P F F + +L+ FS Sbjct: 162 FDENKPMCKS-LNVRVLPFFHFYRGADGQLESFS 194 >At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thioredoxin 2 from Saccharomyces cerevisiae GI:173050, 3'-end of protein contains similarity to thioredoxins; contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin o (TRXO2) GI:15081458 Length = 159 Score = 44.8 bits (101), Expect = 3e-05 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 3/94 (3%) Frame = +2 Query: 119 IKDSDDLKTRLAEAGDKLV--VIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXX 292 +K + + L++A D + V F A WCGPC++I P + E++ + Sbjct: 54 LKSEAEFNSALSKARDGSLPSVFYFTAAWCGPCRLISPVILELSNKYPDVTTYKVDIDEG 113 Query: 293 XXXXA-SEYNINSMPTFVFVKNGKKLDEFSGANV 391 A + N++++PT F K G K E G +V Sbjct: 114 GLSNAIGKLNVSAVPTLQFFKGGVKKAEIVGVDV 147 >At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to ESTs gb|T46281, gb|R83933, gb|N65879, emb|F14466, gb|N96726, gb|AA042340, and emb|Z18150 Length = 275 Score = 44.8 bits (101), Expect = 3e-05 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 1/91 (1%) Frame = +2 Query: 119 IKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXX 298 I + +L L AGDKLVV+DF + CG CK + PK+ + AEM Sbjct: 102 ISSAQELVDSLTNAGDKLVVVDFFSPGCGGCKALHPKICQF-AEMNPDVQFLQVNYEEHK 160 Query: 299 XXASEYNINSMPTFVFVKNGK-KLDEFSGAN 388 ++ +P F F + + ++ FS N Sbjct: 161 SMCYSLGVHVLPFFRFYRGSQGRVCSFSCTN 191 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 43.6 bits (98), Expect = 7e-05 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 1/90 (1%) Frame = +2 Query: 113 IHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXX 292 + I+ ++ L L AGD+LVV+DF + CG CK + PK+ ++ AE Sbjct: 88 LEIQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKICQL-AETNPNVMFLKVNQEE 146 Query: 293 XXXXASEYNINSMPTFVFVKNGK-KLDEFS 379 N++ +P F F + + K+ FS Sbjct: 147 LRTMCHGLNVHVLPFFKFYRGAEGKVCSFS 176 >At3g56420.1 68416.m06275 thioredoxin family protein similar to thioredoxin [Nicotiana tabacum] GI:20047; contains Pfam profile: PF00085 Thioredoxin Length = 100 Score = 43.6 bits (98), Expect = 7e-05 Identities = 20/65 (30%), Positives = 34/65 (52%) Frame = +2 Query: 191 ATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVKNGKKLD 370 A WC PCK I P ++A+ ++E+N+ + PT VF+K+G+++D Sbjct: 17 APWCVPCKKIEPVFRDLASRYPSMIFVTVDVEELAEF-SNEWNVEATPTVVFLKDGRQMD 75 Query: 371 EFSGA 385 + GA Sbjct: 76 KLVGA 80 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 43.2 bits (97), Expect = 1e-04 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 2/65 (3%) Frame = +2 Query: 161 GDKLV--VIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMP 334 GD+ V ++DF ATWCGPC ++ +L+ +A E A + + +P Sbjct: 91 GDRKVPLIVDFYATWCGPCILMAQELEMLAVEYESNAIIVKVDTDDEYEFARDMQVRGLP 150 Query: 335 TFVFV 349 T F+ Sbjct: 151 TLFFI 155 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 42.3 bits (95), Expect = 2e-04 Identities = 22/74 (29%), Positives = 34/74 (45%) Frame = +2 Query: 173 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 352 +V F A WC P + +E+A AS+ + +MPTF+F+K Sbjct: 27 IVAHFTALWCIPSVFMNSFFEELAFNYKDALFLIVDVDEVKEV-ASQLEVKAMPTFLFLK 85 Query: 353 NGKKLDEFSGANVD 394 +G +D+ GAN D Sbjct: 86 DGNAMDKLVGANPD 99 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 41.5 bits (93), Expect = 3e-04 Identities = 20/76 (26%), Positives = 37/76 (48%), Gaps = 6/76 (7%) Frame = +2 Query: 173 VVIDFMATWCGPCKMIGPKLDEIAAEM-----XXXXXXXXXXXXXXXXXASEYNINSMPT 337 +V++F A WCG C+ + P+ ++ A+E+ A+EY I PT Sbjct: 49 IVVEFYAPWCGHCQKLAPEYEKAASELSSHNPPLALAKIDASEEANKEFANEYKIQGFPT 108 Query: 338 FVFVKN-GKKLDEFSG 382 ++N GK + +++G Sbjct: 109 LKILRNGGKSVQDYNG 124 Score = 38.7 bits (86), Expect = 0.002 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 7/60 (11%) Frame = +2 Query: 86 VSIYLPKMSIHIKDSDDLKTRLAEAGD-------KLVVIDFMATWCGPCKMIGPKLDEIA 244 V+++ I ++++ +K +AE+ D K V+I+F A WCG C+ + P LDE+A Sbjct: 357 VAVHKKSQPIPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAPILDEVA 416 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 40.7 bits (91), Expect = 5e-04 Identities = 19/72 (26%), Positives = 31/72 (43%) Frame = +2 Query: 170 LVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFV 349 +V+++F A WCG CK + P +++A + A +Y I PT Sbjct: 50 VVLVEFFAPWCGHCKALTPTWEKVANILKGVATVAAIDADAHQSAAQDYGIKGFPTIKVF 109 Query: 350 KNGKKLDEFSGA 385 GK ++ GA Sbjct: 110 VPGKAPIDYQGA 121 Score = 33.5 bits (73), Expect = 0.077 Identities = 13/60 (21%), Positives = 24/60 (40%) Frame = +2 Query: 164 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 343 ++L +++F A WCG CK + P+ A + S + + PT + Sbjct: 180 NELWIVEFFAPWCGHCKKLAPEWKRAAKNLQGKVKLGHVNCDVEQSIMSRFKVQGFPTIL 239 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 40.7 bits (91), Expect = 5e-04 Identities = 18/72 (25%), Positives = 37/72 (51%) Frame = +2 Query: 173 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 352 V++ F A WCGPC+ + P L+++ +E ++I+ +PT + K Sbjct: 230 VMVMFTARWCGPCRDMIPILNKMDSEYKNEFKFYTVNFDTEIRFTERFDISYLPTTLVFK 289 Query: 353 NGKKLDEFSGAN 388 G+++ + +GA+ Sbjct: 290 GGEQMAKVTGAD 301 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 39.9 bits (89), Expect = 9e-04 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 6/76 (7%) Frame = +2 Query: 173 VVIDFMATWCGPCKMIGPKLDEIAAEM-----XXXXXXXXXXXXXXXXXASEYNINSMPT 337 +V++F A WCG CK + P+ ++ A+ + A++Y + PT Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPT 109 Query: 338 F-VFVKNGKKLDEFSG 382 +F GK + E++G Sbjct: 110 IKIFRNGGKAVQEYNG 125 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = +2 Query: 128 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIA 244 SD L + +G K V+++F A WCG C+ + P LDE+A Sbjct: 381 SDSLDDIVLNSG-KNVLLEFYAPWCGHCQKLAPILDEVA 418 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 39.9 bits (89), Expect = 9e-04 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 6/76 (7%) Frame = +2 Query: 173 VVIDFMATWCGPCKMIGPKLDEIAAEM-----XXXXXXXXXXXXXXXXXASEYNINSMPT 337 +V++F A WCG CK + P+ ++ A+ + A++Y + PT Sbjct: 50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPT 109 Query: 338 F-VFVKNGKKLDEFSG 382 +F GK + E++G Sbjct: 110 IKIFRNGGKAVQEYNG 125 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = +2 Query: 128 SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIA 244 SD L + +G K V+++F A WCG C+ + P LDE+A Sbjct: 381 SDSLDDIVLNSG-KNVLLEFYAPWCGHCQKLAPILDEVA 418 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/72 (22%), Positives = 32/72 (44%) Frame = +2 Query: 170 LVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFV 349 +V+++F A WCG C+ + P +++A+ + + +Y + PT Sbjct: 48 VVLVEFFAPWCGHCQSLTPTWEKVASTLKGIATVAAIDADAHKSVSQDYGVRGFPTIKVF 107 Query: 350 KNGKKLDEFSGA 385 GK ++ GA Sbjct: 108 VPGKPPIDYQGA 119 Score = 35.5 bits (78), Expect = 0.019 Identities = 21/89 (23%), Positives = 35/89 (39%), Gaps = 2/89 (2%) Frame = +2 Query: 101 PKMSIHIKDS--DDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXX 274 P S+ + S D+L T E L +++F A WCG CK + P+ + A + Sbjct: 162 PSASVELNSSNFDELVTESKE----LWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLG 217 Query: 275 XXXXXXXXXXASEYNINSMPTFVFVKNGK 361 S + + PT + + K Sbjct: 218 HVNCDAEQSIKSRFKVQGFPTILVFGSDK 246 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 38.7 bits (86), Expect = 0.002 Identities = 19/77 (24%), Positives = 33/77 (42%), Gaps = 3/77 (3%) Frame = +2 Query: 173 VVIDFMATWCGPCKMIGPKLD---EIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 343 + +DF A WCG CK + P+LD I A++ A + I++ PT + Sbjct: 52 IFVDFYAPWCGHCKRLNPELDAAAPILAKLKQPIVIAKLNADKYSRLARKIEIDAFPTLM 111 Query: 344 FVKNGKKLDEFSGANVD 394 +G ++ + D Sbjct: 112 LYNHGVPMEYYGPRKAD 128 >At5g04260.1 68418.m00417 thioredoxin family protein low similarity to SP|P29429 Thioredoxin. [Aspergillus nidulans] {Emericella nidulans}; contains Pfam profile: PF00085 Thioredoxin Length = 192 Score = 37.9 bits (84), Expect = 0.004 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 1/73 (1%) Frame = +2 Query: 173 VVIDFMATWCGPCKMIGPKLDEIAAEM-XXXXXXXXXXXXXXXXXASEYNINSMPTFVFV 349 VVI +MA WC C + PKL+++AAE S + MPT Sbjct: 101 VVIVWMAAWCRKCIYLKPKLEKLAAEFYPRLRFYHVDVNAVPYRLVSRAGVTKMPTIQLW 160 Query: 350 KNGKKLDEFSGAN 388 ++G+K E G + Sbjct: 161 RDGQKQAEVIGGH 173 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 37.5 bits (83), Expect = 0.005 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = +2 Query: 164 DKLVVIDFMATWCGPCKMIGPKLDEIAAEM-XXXXXXXXXXXXXXXXXASEYNINSMPTF 340 ++ V+++F A WCG C+ + P+ A E+ A EY + PT Sbjct: 120 NQYVLVEFYAPWCGHCQSLAPEYAAAATELKEDGVVLAKIDATEENELAQEYRVQGFPTL 179 Query: 341 VFVKNGK 361 +F +G+ Sbjct: 180 LFFVDGE 186 Score = 30.7 bits (66), Expect = 0.54 Identities = 15/69 (21%), Positives = 26/69 (37%) Frame = +2 Query: 167 KLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVF 346 K V+++ A WCG C+ + P +++A + + PT +F Sbjct: 460 KDVLLEVYAPWCGHCQALEPMYNKLAKHLRSIDSLVITKMDGTTNEHPKAKAEGFPTILF 519 Query: 347 VKNGKKLDE 373 G K E Sbjct: 520 FPAGNKTSE 528 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 37.5 bits (83), Expect = 0.005 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = +2 Query: 164 DKLVVIDFMATWCGPCKMIGPKLDEIAAEM-XXXXXXXXXXXXXXXXXASEYNINSMPTF 340 ++ V+++F A WCG C+ + P+ A E+ A EY + PT Sbjct: 120 NQYVLVEFYAPWCGHCQSLAPEYAAAATELKEDGVVLAKIDATEENELAQEYRVQGFPTL 179 Query: 341 VFVKNGK 361 +F +G+ Sbjct: 180 LFFVDGE 186 Score = 30.7 bits (66), Expect = 0.54 Identities = 15/69 (21%), Positives = 26/69 (37%) Frame = +2 Query: 167 KLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVF 346 K V+++ A WCG C+ + P +++A + + PT +F Sbjct: 460 KDVLLEVYAPWCGHCQALEPMYNKLAKHLRSIDSLVITKMDGTTNEHPKAKAEGFPTILF 519 Query: 347 VKNGKKLDE 373 G K E Sbjct: 520 FPAGNKTSE 528 >At5g06690.1 68418.m00756 thioredoxin family protein low similiarity to SP|P34723 Thioredoxin {Penicillium chrysogenum}; contains Pfam profile: PF00085 Thioredoxin Length = 210 Score = 37.5 bits (83), Expect = 0.005 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 1/73 (1%) Frame = +2 Query: 173 VVIDFMATWCGPCKMIGPKLDEIAAEM-XXXXXXXXXXXXXXXXXASEYNINSMPTFVFV 349 ++I++MA+WC C + PKL+++AAE NI+ MPT Sbjct: 121 IIIEWMASWCRKCIYLKPKLEKLAAEYNNRAKFYYVDVNKVPQTLVKRGNISKMPTIQLW 180 Query: 350 KNGKKLDEFSGAN 388 K + +E G + Sbjct: 181 KEDEMKEEVIGGH 193 >At4g04950.1 68417.m00719 thioredoxin family protein similar to PKCq-interacting protein PICOT from [Mus musculus] GI:6840949, [Rattus norvegicus] GI:6840951; contains Pfam profile PF00085: Thioredoxin Length = 488 Score = 37.5 bits (83), Expect = 0.005 Identities = 19/72 (26%), Positives = 32/72 (44%) Frame = +2 Query: 173 VVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVFVK 352 VV+ F A+WC K + +A + + Y++ ++P FVF K Sbjct: 24 VVLHFWASWCDASKQMDQVFSHLATDFPRAHFFRVEAEEHPEI-SEAYSVAAVPYFVFFK 82 Query: 353 NGKKLDEFSGAN 388 +GK +D GA+ Sbjct: 83 DGKTVDTLEGAD 94 >At1g76080.1 68414.m08835 thioredoxin family protein low similarity to thioredoxin (TRX) [Fasciola hepatica] GI:6687568; contains Pfam profile PF00085: Thioredoxin Length = 302 Score = 37.1 bits (82), Expect = 0.006 Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 3/78 (3%) Frame = +2 Query: 161 GDKLVVIDFMATWCGPCKMIGP---KLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSM 331 G KL+V+D CGPC + P KL +E + N+ + Sbjct: 206 GGKLIVLDVGLKHCGPCVKVYPTVLKLSRSMSETVVFARMNGDENDSCMEFLKDMNVIEV 265 Query: 332 PTFVFVKNGKKLDEFSGA 385 PTF+F+++G+ + G+ Sbjct: 266 PTFLFIRDGEIRGRYVGS 283 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 37.1 bits (82), Expect = 0.006 Identities = 25/118 (21%), Positives = 48/118 (40%), Gaps = 2/118 (1%) Frame = +2 Query: 35 LSLACFLFAF*TVILFLVSIYLPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCK 214 ++L L A ++L + I L K + + ++ E D + F WC CK Sbjct: 1 MTLGARLVAPMIILLLFIPIELVKAEVITLTPETFSDKIKEK-DTAWFVKFCVPWCKHCK 59 Query: 215 MIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA--SEYNINSMPTFVFVKNGKKLDEFSG 382 +G +++ M A ++ I+S PTF+ NG+++ ++ G Sbjct: 60 KLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKG 117 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 37.1 bits (82), Expect = 0.006 Identities = 25/118 (21%), Positives = 48/118 (40%), Gaps = 2/118 (1%) Frame = +2 Query: 35 LSLACFLFAF*TVILFLVSIYLPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCK 214 ++L L A ++L + I L K + + ++ E D + F WC CK Sbjct: 1 MTLGARLVAPMIILLLFIPIELVKAEVITLTPETFSDKIKEK-DTAWFVKFCVPWCKHCK 59 Query: 215 MIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA--SEYNINSMPTFVFVKNGKKLDEFSG 382 +G +++ M A ++ I+S PTF+ NG+++ ++ G Sbjct: 60 KLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKG 117 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 37.1 bits (82), Expect = 0.006 Identities = 25/118 (21%), Positives = 48/118 (40%), Gaps = 2/118 (1%) Frame = +2 Query: 35 LSLACFLFAF*TVILFLVSIYLPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCK 214 ++L L A ++L + I L K + + ++ E D + F WC CK Sbjct: 1 MTLGARLVAPMIILLLFIPIELVKAEVITLTPETFSDKIKEK-DTAWFVKFCVPWCKHCK 59 Query: 215 MIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA--SEYNINSMPTFVFVKNGKKLDEFSG 382 +G +++ M A ++ I+S PTF+ NG+++ ++ G Sbjct: 60 KLGNLWEDLGKAMEGDDEIEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKG 117 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 36.7 bits (81), Expect = 0.008 Identities = 16/73 (21%), Positives = 28/73 (38%) Frame = +2 Query: 164 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFV 343 + +++F A WCG C+ + P+ A E+ A +Y I PT Sbjct: 116 NSFAMVEFYAPWCGACQALTPEYAAAATELKGLAALAKIDATEEGDLAQKYEIQGFPTVF 175 Query: 344 FVKNGKKLDEFSG 382 +G+ + G Sbjct: 176 LFVDGEMRKTYEG 188 Score = 27.1 bits (57), Expect = 6.7 Identities = 15/76 (19%), Positives = 27/76 (35%) Frame = +2 Query: 167 KLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNINSMPTFVF 346 K V+++ A WCG C+ P +++ + + PT +F Sbjct: 456 KDVLLEIYAPWCGHCQSFEPIYNKLGKYLKGIDSLVVAKMDGTSNEHPRAKADGFPTILF 515 Query: 347 VKNGKKLDEFSGANVD 394 G K + +VD Sbjct: 516 FPGGNKSFDPIAVDVD 531 >At3g53220.1 68416.m05864 thioredoxin family protein low similarity to SP|P29451 Thioredoxin [Rhesus macaque] {Macaca mulatta}; contains Pfam profile: PF00085 Thioredoxin Length = 126 Score = 36.7 bits (81), Expect = 0.008 Identities = 24/85 (28%), Positives = 39/85 (45%) Frame = +2 Query: 131 DDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXAS 310 DD+K+ + A VI++ A+WCG C I P +++ + Sbjct: 37 DDIKSSKSPA-----VINYGASWCGVCSQILPAFRKLSNSFSKLKFVYADIDECPE---T 88 Query: 311 EYNINSMPTFVFVKNGKKLDEFSGA 385 +I PTF F ++G+K+DE GA Sbjct: 89 TRHIRYTPTFQFYRDGEKVDEMFGA 113 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 36.3 bits (80), Expect = 0.011 Identities = 19/64 (29%), Positives = 32/64 (50%) Frame = +2 Query: 56 FAF*TVILFLVSIYLPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLD 235 F F + L LVS + + DS + + DK +++F A WCG CK + P+ + Sbjct: 8 FGFALLALLLVSAVADDVVVLTDDSFEKEV----GKDKGALVEFYAPWCGHCKKLAPEYE 63 Query: 236 EIAA 247 ++ A Sbjct: 64 KLGA 67 Score = 35.5 bits (78), Expect = 0.019 Identities = 19/76 (25%), Positives = 33/76 (43%), Gaps = 3/76 (3%) Frame = +2 Query: 164 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA--SEYNINSMPT 337 +K V+++F A WCG CK + P +++A A +Y ++ PT Sbjct: 159 NKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPT 218 Query: 338 F-VFVKNGKKLDEFSG 382 F K+ K ++ G Sbjct: 219 LKFFPKDNKAGHDYDG 234 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 36.3 bits (80), Expect = 0.011 Identities = 19/64 (29%), Positives = 32/64 (50%) Frame = +2 Query: 56 FAF*TVILFLVSIYLPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLD 235 F F + L LVS + + DS + + DK +++F A WCG CK + P+ + Sbjct: 8 FGFALLALLLVSAVADDVVVLTDDSFEKEV----GKDKGALVEFYAPWCGHCKKLAPEYE 63 Query: 236 EIAA 247 ++ A Sbjct: 64 KLGA 67 Score = 35.5 bits (78), Expect = 0.019 Identities = 19/76 (25%), Positives = 33/76 (43%), Gaps = 3/76 (3%) Frame = +2 Query: 164 DKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXA--SEYNINSMPT 337 +K V+++F A WCG CK + P +++A A +Y ++ PT Sbjct: 159 NKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPT 218 Query: 338 F-VFVKNGKKLDEFSG 382 F K+ K ++ G Sbjct: 219 LKFFPKDNKAGHDYDG 234 >At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 160 Score = 35.9 bits (79), Expect = 0.014 Identities = 26/96 (27%), Positives = 41/96 (42%), Gaps = 2/96 (2%) Frame = +2 Query: 107 MSIHIKD--SDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXX 280 MS +KD S + L +G LV + F A+WC K + +A + Sbjct: 1 MSGTVKDIVSKEELDNLRHSGAPLV-LHFWASWCDASKQMDQVFSHLATDFPRAHFFRVE 59 Query: 281 XXXXXXXXASEYNINSMPTFVFVKNGKKLDEFSGAN 388 + Y++ +P FVF K+GK +D GA+ Sbjct: 60 AEEHPEI-SEAYSVALVPYFVFFKDGKTVDTLEGAD 94 >At1g60420.1 68414.m06802 DC1 domain-containing protein contains Pfam domain PF03107: DC1 domain Length = 578 Score = 34.3 bits (75), Expect = 0.044 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +2 Query: 116 HIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMIGPKLDEI 241 ++ D K +++ K +++ F A WC PC+ PKL E+ Sbjct: 347 YVLGKDGAKVLVSDLVGKTILMYFSAHWCPPCRAFTPKLVEV 388 Score = 32.7 bits (71), Expect = 0.13 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 167 KLVVIDFMATWCGPCKMIGPKLDEIAAEM 253 K + + F A WCGPC+ P+L E+ E+ Sbjct: 44 KKIGLYFSAAWCGPCQRFTPQLVEVYNEL 72 >At5g60620.1 68418.m07608 phospholipid/glycerol acyltransferase family protein contains Pfam PF01553: Acyltransferase Length = 376 Score = 33.9 bits (74), Expect = 0.058 Identities = 18/63 (28%), Positives = 35/63 (55%) Frame = +2 Query: 41 LACFLFAF*TVILFLVSIYLPKMSIHIKDSDDLKTRLAEAGDKLVVIDFMATWCGPCKMI 220 L CF AF +I +S+++P ++ +K D L+ ++ +++ F+A+W G K Sbjct: 99 LRCFTLAFGWIIF--LSLFIPVNAL-LKGQDRLRKKIERVLVEMICSFFVASWTGVVKYH 155 Query: 221 GPK 229 GP+ Sbjct: 156 GPR 158 >At1g07700.3 68414.m00829 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 217 Score = 33.5 bits (73), Expect = 0.077 Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 9/95 (9%) Frame = +2 Query: 122 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIA-------AEMXXXXXXX 274 K D+L + L ++ + LVV+DF T CG CK I ++ A + Sbjct: 104 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPVIFLKHNV 163 Query: 275 XXXXXXXXXXASEYNINSMPTFVFVKNGKKLDEFS 379 A I ++P F F KNG L+ F+ Sbjct: 164 VDEYDEQSEVAERLRIKAVPLFHFYKNGVLLESFA 198 >At1g07700.1 68414.m00828 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 204 Score = 33.5 bits (73), Expect = 0.077 Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 9/95 (9%) Frame = +2 Query: 122 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMIGPKLDEIA-------AEMXXXXXXX 274 K D+L + L ++ + LVV+DF T CG CK I ++ A + Sbjct: 91 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPVIFLKHNV 150 Query: 275 XXXXXXXXXXASEYNINSMPTFVFVKNGKKLDEFS 379 A I ++P F F KNG L+ F+ Sbjct: 151 VDEYDEQSEVAERLRIKAVPLFHFYKNGVLLESFA 185 >At3g03860.1 68416.m00398 expressed protein Length = 300 Score = 32.3 bits (70), Expect = 0.18 Identities = 22/88 (25%), Positives = 39/88 (44%), Gaps = 1/88 (1%) Frame = +2 Query: 89 SIYLPKMSIHIKDSDDLKTRLA-EAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXX 265 S+Y P I + D D L +A + G+ + + F A+WC + + PK D +++ Sbjct: 50 SLY-PTPPIEV-DGDSLDRLMASQHGNAYMSVLFYASWCPFSRAVRPKFDMLSSMFPQIQ 107 Query: 266 XXXXXXXXXXXXXASEYNINSMPTFVFV 349 S Y I+S+P+ + V Sbjct: 108 HLAVEHSQALPSVFSRYGIHSLPSILMV 135 >At2g41680.1 68415.m05149 thioredoxin reductase, putative / NADPH-dependent thioredoxin reductase, putative The last 2 exons encode thioredoxin. There is an EST match to exons 5-7, and the distance between exon 7 and exon 8 is only 90bp. It is unlikely this is two separate genes, but more likely a hybrid protein. Length = 529 Score = 31.9 bits (69), Expect = 0.24 Identities = 17/82 (20%), Positives = 32/82 (39%) Frame = +2 Query: 146 RLAEAGDKLVVIDFMATWCGPCKMIGPKLDEIAAEMXXXXXXXXXXXXXXXXXASEYNIN 325 +L +++++ + + CGPC+ + P L+++ E A I Sbjct: 436 KLYHESPRVILVLYTSPTCGPCRTLKPILNKVVDEYNHDVHFVEIDIEEDQEIAEAAGIM 495 Query: 326 SMPTFVFVKNGKKLDEFSGANV 391 P F KN + L SG + Sbjct: 496 GTPCVQFFKNKEMLRTISGVKM 517 >At1g07700.2 68414.m00827 thioredoxin family protein low similarity to thioredoxin [Gallus gallus] GI:212766; contains Pfam profile: PF00085 Thioredoxin Length = 171 Score = 29.1 bits (62), Expect = 1.7 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +2 Query: 122 KDSDDLKTRLAEAGD--KLVVIDFMATWCGPCKMI 220 K D+L + L ++ + LVV+DF T CG CK I Sbjct: 91 KTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYI 125 >At4g31240.2 68417.m04435 expressed protein Length = 392 Score = 27.9 bits (59), Expect = 3.8 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 167 KLVVIDFMATWCGPCKMIGPKL 232 K + + F A WC PCK P+L Sbjct: 44 KTICLFFSAIWCRPCKDFTPEL 65 >At4g31240.1 68417.m04434 expressed protein Length = 392 Score = 27.9 bits (59), Expect = 3.8 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 167 KLVVIDFMATWCGPCKMIGPKL 232 K + + F A WC PCK P+L Sbjct: 44 KTICLFFSAIWCRPCKDFTPEL 65 >At2g29040.1 68415.m03530 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 720 Score = 27.9 bits (59), Expect = 3.8 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +1 Query: 31 YVVTCVFLICILNCDIIFSFNLSAQDVHSHQRFRRPED 144 YV FL+ ++ +++ F+ SA+ VH+H+R R E+ Sbjct: 16 YVAMASFLLWLV---LLYLFSSSAKTVHNHERLFRQEN 50 >At1g78740.1 68414.m09177 hypothetical protein Length = 306 Score = 27.5 bits (58), Expect = 5.1 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 432 SIYLCLRIVVLSLSTLA-PENSSSFLPFLTKTNVG 331 +IY+C +V L LST+ P S LPFL +G Sbjct: 94 TIYICESLVSLKLSTVTLPSVKSVSLPFLRVLKLG 128 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 27.5 bits (58), Expect = 5.1 Identities = 19/81 (23%), Positives = 30/81 (37%), Gaps = 3/81 (3%) Frame = +2 Query: 161 GDKLVVIDFMATWCGPCKMIGPKLDEIAA---EMXXXXXXXXXXXXXXXXXASEYNINSM 331 G++ V++ A WC + P+ E A E+ ASE I Sbjct: 93 GNEFVMVLGYAPWCARSAELMPRFAEAATALKEIGSSVLMAKIDGDRYSKIASELEIKGF 152 Query: 332 PTFVFVKNGKKLDEFSGANVD 394 PT + NG L G++ + Sbjct: 153 PTLLLFVNGTSLTYNGGSSAE 173 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,154,330 Number of Sequences: 28952 Number of extensions: 156885 Number of successful extensions: 573 Number of sequences better than 10.0: 63 Number of HSP's better than 10.0 without gapping: 521 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 545 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 838967680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -