BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10a11r (567 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0382 - 5076673-5077774,5078122-5078186 29 2.0 05_01_0234 - 1743784-1744017,1748103-1749068 28 4.5 01_07_0359 - 43042675-43042758,43042956-43043024,43043099-430431... 27 7.9 >04_01_0382 - 5076673-5077774,5078122-5078186 Length = 388 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 Query: 229 KVKPTPPPVRRTLANCVDPRTRTALTRLP 315 K PTPPP RR N +D R + RLP Sbjct: 256 KKLPTPPPKRRLGINMLDGRNKLVEYRLP 284 >05_01_0234 - 1743784-1744017,1748103-1749068 Length = 399 Score = 28.3 bits (60), Expect = 4.5 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +1 Query: 280 DPRTRTA-LTRLPAGAVNLTLTTRELIVAARLTTKLRKSLSLEVILPILKALALSVDLGS 456 DP+ A ++L V + + R+ L +LRKSL + +I P L+ ALSV+ + Sbjct: 196 DPKANIASASQLRGLGVKIRMAKRDR--GGILDVRLRKSLEIRLIPPELEVPALSVEEAT 253 Query: 457 ATSL 468 A L Sbjct: 254 AVLL 257 >01_07_0359 - 43042675-43042758,43042956-43043024,43043099-43043159, 43043260-43043768,43044545-43045153,43045697-43045972, 43046581-43046769,43047006-43047116,43047621-43047908, 43047990-43048041,43048648-43048824,43049249-43049314, 43049675-43049929,43050071-43050577,43050807-43050886, 43050974-43051207 Length = 1188 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 223 FTKVKPTPPPVRRTLANCVDPRTRTALTRLPAGAVN 330 F+ + P P+RR +A+C+ P T P A + Sbjct: 32 FSSARKPPEPLRRAVADCLSPPAPHTHTHAPPPAAS 67 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,777,713 Number of Sequences: 37544 Number of extensions: 229762 Number of successful extensions: 629 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 628 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1305140760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -