SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV10a10r
         (705 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292355-1|CAL23167.1|  324|Tribolium castaneum gustatory recept...    23   3.2  
AM292348-1|CAL23160.2|  346|Tribolium castaneum gustatory recept...    23   3.2  
AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain tran...    21   9.8  
AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia or...    21   9.8  

>AM292355-1|CAL23167.1|  324|Tribolium castaneum gustatory receptor
           candidate 34 protein.
          Length = 324

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 7/19 (36%), Positives = 14/19 (73%)
 Frame = +2

Query: 206 ILYLFIHTLNGKYSQINKL 262
           ++YL + T+  KY Q+++L
Sbjct: 145 MIYLILDTIKSKYRQMHRL 163


>AM292348-1|CAL23160.2|  346|Tribolium castaneum gustatory receptor
           candidate 27 protein.
          Length = 346

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 11/32 (34%), Positives = 16/32 (50%)
 Frame = -1

Query: 294 FVVCNFDLSVFSLFICEYFPFKVCMNRYNILY 199
           FVV +F ++ FS +IC    + V     N  Y
Sbjct: 36  FVVFSFAVTFFSAWICALVNYNVSEISENFYY 67


>AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain
           transcription factor Maxillopediaprotein.
          Length = 523

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +1

Query: 580 YHHTGYHHPND 612
           Y+H GYH+  D
Sbjct: 388 YNHYGYHYSGD 398


>AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia
           ortholog protein.
          Length = 471

 Score = 21.0 bits (42), Expect = 9.8
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +1

Query: 580 YHHTGYHHPND 612
           Y+H GYH+  D
Sbjct: 336 YNHYGYHYSGD 346


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 143,780
Number of Sequences: 336
Number of extensions: 3019
Number of successful extensions: 5
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18634795
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -