BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10a10f (605 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 24 1.1 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 22 4.6 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 21 6.1 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 21 8.1 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.8 bits (49), Expect = 1.1 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -2 Query: 484 FCKFSIVVRTSKGVGNSVSPYPEQSTTKLLESPSVWHT 371 +C FS+ S N V P+PE+S + +P +W++ Sbjct: 313 YCAFSLYPLKSTFYLNVVRPFPERS---MGITPMIWNS 347 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.8 bits (44), Expect = 4.6 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -3 Query: 114 SATTGRGV*ASWSLTNAITDATCRLSSGV 28 SAT+G G + SLT + A C S V Sbjct: 122 SATSGGGANLTNSLTGPVRPAACTPDSRV 150 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.4 bits (43), Expect = 6.1 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 166 GIGVSSDFIPASQVTSVISNN 104 G+G S ++ A +VT V NN Sbjct: 128 GVGFYSAYLVADKVTVVSKNN 148 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 21.0 bits (42), Expect = 8.1 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 179 ICFNWNRRFVGFYPSFTSD*CDQ 111 IC + N F+G YP+ T D+ Sbjct: 52 ICTHINYAFLGVYPNGTLQMIDE 74 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,857 Number of Sequences: 336 Number of extensions: 2240 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15352827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -