BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10a08r (779 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66519-5|CAA91382.2| 500|Caenorhabditis elegans Hypothetical pr... 66 2e-11 Z70038-4|CAA93881.1| 427|Caenorhabditis elegans Hypothetical pr... 29 2.8 >Z66519-5|CAA91382.2| 500|Caenorhabditis elegans Hypothetical protein B0334.5 protein. Length = 500 Score = 66.5 bits (155), Expect = 2e-11 Identities = 28/57 (49%), Positives = 41/57 (71%) Frame = -2 Query: 685 ASFHKVIVIIGFLSLFHTAFSATQHRSYLRITSQEFTTLPLDIVIQAVVSLFAVMWG 515 ++ +++I I+ LSL H A+SA QHR YLR+T Q F LP D+V Q V+SL A+++G Sbjct: 3 STIYRLITIVSLLSLLHCAYSAAQHRFYLRLTEQPFINLPSDVVAQTVISLIALIYG 59 >Z70038-4|CAA93881.1| 427|Caenorhabditis elegans Hypothetical protein ZK1067.5 protein. Length = 427 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/62 (22%), Positives = 34/62 (54%), Gaps = 2/62 (3%) Frame = -2 Query: 778 HMMQXCIAVFVNNYYNLHLFILSCY*SVHNMASFHKVIVI--IGFLSLFHTAFSATQHRS 605 ++ + C V++Y+ H F++SC+ + +A FH V++ + ++ F+ +H++ Sbjct: 102 YISKYCSVSIVSHYF--HFFLISCFLANLRLALFHLVLIFATVAYIIAGAYLFTKIEHQA 159 Query: 604 YL 599 L Sbjct: 160 EL 161 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,700,765 Number of Sequences: 27780 Number of extensions: 336293 Number of successful extensions: 812 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 734 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 812 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1882685842 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -