BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10a07r (782 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 22 4.8 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 8.4 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 22.2 bits (45), Expect = 4.8 Identities = 22/81 (27%), Positives = 33/81 (40%), Gaps = 2/81 (2%) Frame = +3 Query: 216 FYSMRLIKLYLNFLTNCYNLCF*CSNRLKMLRN-HGLIQNNFTRLCKSMVTLDSTLGPLC 392 F + I +LNF+ +C N + C R +L + Q + C +V L C Sbjct: 140 FVILLWISFFLNFMLHCNNTTWRCLYRWIVLYTLSKMSQVMLIQFCAFVVVLKQ---KFC 196 Query: 393 VVGS*TK-VTMIKD*IYLNLL 452 VV K V + + Y N L Sbjct: 197 VVNQYIKQVCKLNNGHYKNFL 217 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 470 YLAMKS*EVEVYLIFDHC 417 +L ++S V YL+FD+C Sbjct: 491 HLIVRSVFVTTYLMFDYC 508 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,607 Number of Sequences: 336 Number of extensions: 2761 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21168876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -