BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10a07r (782 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6937| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_19910| Best HMM Match : C1_4 (HMM E-Value=3.2) 28 9.8 >SB_6937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +3 Query: 294 RLKMLRNHGLIQNNFTRLCKSMVTLDST 377 R K L NH L Q FTRL K+ V + T Sbjct: 21 RCKELENHKLYQGLFTRLLKAEVRAEKT 48 >SB_19910| Best HMM Match : C1_4 (HMM E-Value=3.2) Length = 201 Score = 27.9 bits (59), Expect = 9.8 Identities = 19/62 (30%), Positives = 25/62 (40%) Frame = +3 Query: 171 HFKLLNSF*RILNT*FYSMRLIKLYLNFLTNCYNLCF*CSNRLKMLRNHGLIQNNFTRLC 350 HF +NS +L +Y K Y C NLC+ C L + Q TRL Sbjct: 69 HFDYINSMPGMLGRCYYCTSCQKGYDRRNHKCNNLCYGCVLTLNRHESEDSTQRMRTRLH 128 Query: 351 KS 356 K+ Sbjct: 129 KA 130 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,618,333 Number of Sequences: 59808 Number of extensions: 275786 Number of successful extensions: 427 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 389 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 420 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2143884611 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -