BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10a04f (627 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g36250.2 68415.m04450 chloroplast division protein FtsZ (FtsZ... 29 3.3 At2g36250.1 68415.m04449 chloroplast division protein FtsZ (FtsZ... 29 3.3 At2g48020.2 68415.m06011 sugar transporter, putative similar to ... 28 4.4 At2g48020.1 68415.m06010 sugar transporter, putative similar to ... 28 4.4 At3g18080.1 68416.m02299 glycosyl hydrolase family 1 protein con... 28 5.8 >At2g36250.2 68415.m04450 chloroplast division protein FtsZ (FtsZ2-1) identical to chloroplast division protein AtFtsZ2-1 [Arabidopsis thaliana] GI:15636809, plastid division protein FtsZ [Arabidopsis thaliana] GI:14195704 Length = 478 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/51 (23%), Positives = 24/51 (47%) Frame = +1 Query: 433 AGANYNLGDNQVVWAAGWGATSLGGSNSEQLRHVQVWTINQNACVQRYRPI 585 A +NYN +V+ G G+ ++ ++ V+ W +N + R P+ Sbjct: 112 APSNYNEARIKVIGVGGGGSNAVNRMIESEMSGVEFWIVNTDIQAMRMSPV 162 >At2g36250.1 68415.m04449 chloroplast division protein FtsZ (FtsZ2-1) identical to chloroplast division protein AtFtsZ2-1 [Arabidopsis thaliana] GI:15636809, plastid division protein FtsZ [Arabidopsis thaliana] GI:14195704 Length = 478 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/51 (23%), Positives = 24/51 (47%) Frame = +1 Query: 433 AGANYNLGDNQVVWAAGWGATSLGGSNSEQLRHVQVWTINQNACVQRYRPI 585 A +NYN +V+ G G+ ++ ++ V+ W +N + R P+ Sbjct: 112 APSNYNEARIKVIGVGGGGSNAVNRMIESEMSGVEFWIVNTDIQAMRMSPV 162 >At2g48020.2 68415.m06011 sugar transporter, putative similar to ERD6 protein {Arabidopsis thaliana} GI:3123712, sugar-porter family proteins 1 and 2 [Arabidopsis thaliana] GI:14585699, GI:14585701; contains Pfam profile PF00083: major facilitator superfamily protein Length = 463 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 79 PTNPQRIIGGSTTNINQYPGIAALLYTWNWNQWWQSCG 192 P N + + GG T +N + G A+ YT+N+ W S G Sbjct: 390 PINIKGVAGGMATLVNWF-GAWAVSYTFNFLMSWSSYG 426 >At2g48020.1 68415.m06010 sugar transporter, putative similar to ERD6 protein {Arabidopsis thaliana} GI:3123712, sugar-porter family proteins 1 and 2 [Arabidopsis thaliana] GI:14585699, GI:14585701; contains Pfam profile PF00083: major facilitator superfamily protein Length = 463 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 79 PTNPQRIIGGSTTNINQYPGIAALLYTWNWNQWWQSCG 192 P N + + GG T +N + G A+ YT+N+ W S G Sbjct: 390 PINIKGVAGGMATLVNWF-GAWAVSYTFNFLMSWSSYG 426 >At3g18080.1 68416.m02299 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to beta-glucosidase BGQ60 precursor GB:A57512 [Hordeum vulgare]; similar to beta-mannosidase enzyme (GI:17226270) [Lycopersicon esculentum] Length = 512 Score = 27.9 bits (59), Expect = 5.8 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -3 Query: 490 HPNQQPKQLGYHQDCN 443 HP +PK LGY QD N Sbjct: 356 HPTTKPKDLGYQQDWN 371 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,255,008 Number of Sequences: 28952 Number of extensions: 324438 Number of successful extensions: 933 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 933 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -