BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10a02f (544 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 25 0.43 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 25 0.43 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 4.0 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 5.3 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 5.3 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 5.3 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 5.3 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 25.0 bits (52), Expect = 0.43 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = -2 Query: 222 NVIILHYIGDLTIPCFVKTQNSIPSFSMRRR*YWFYGFCTNFYCLPCRHFRSE 64 N ++ H L +P + N I + + ++ Y Y F TNF L RSE Sbjct: 389 NTVLGHQNPYLALPKTDSSDNRILNNLLDKKPYSTYKFPTNFDALIVNEMRSE 441 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 25.0 bits (52), Expect = 0.43 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = -2 Query: 222 NVIILHYIGDLTIPCFVKTQNSIPSFSMRRR*YWFYGFCTNFYCLPCRHFRSE 64 N ++ H L +P + N I + + ++ Y Y F TNF L RSE Sbjct: 281 NTVLGHQNPYLALPKTDSSDNRILNNLLDKKPYSTYKFPTNFDALIVNEMRSE 333 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.8 bits (44), Expect = 4.0 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = -2 Query: 387 EVGHNVPLLFPYVHRLFQLHLTLNN 313 E GHN PL P +Q L + + Sbjct: 288 ETGHNAPLYSPSSDSQYQKQLNVEH 312 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 5.3 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +1 Query: 376 MAYFKPTEEPKPKNFLSKFFS 438 M +FK +++P +FL FF+ Sbjct: 153 MCFFKSSKKPAFSHFLIVFFT 173 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 5.3 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +1 Query: 376 MAYFKPTEEPKPKNFLSKFFS 438 M +FK +++P +FL FF+ Sbjct: 153 MCFFKSSKKPAFSHFLIVFFT 173 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 5.3 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +1 Query: 376 MAYFKPTEEPKPKNFLSKFFS 438 M +FK +++P +FL FF+ Sbjct: 153 MCFFKSSKKPAFSHFLIVFFT 173 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 5.3 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +1 Query: 376 MAYFKPTEEPKPKNFLSKFFS 438 M +FK +++P +FL FF+ Sbjct: 153 MCFFKSSKKPAFSHFLIVFFT 173 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,698 Number of Sequences: 336 Number of extensions: 2663 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13306679 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -