BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV10a01f (591 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF022967-5|AAB69878.1| 537|Caenorhabditis elegans Hypothetical ... 29 2.5 U23510-10|AAC46780.1| 979|Caenorhabditis elegans Hypothetical p... 27 10.0 >AF022967-5|AAB69878.1| 537|Caenorhabditis elegans Hypothetical protein C13A2.6 protein. Length = 537 Score = 29.1 bits (62), Expect = 2.5 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 169 RYPRAWTRPNLHRKSRRRLHFPNF*HLQR 255 RY W + H ++RR + PN H+QR Sbjct: 374 RYNSTWIHYSYHDENRREIESPNLVHVQR 402 >U23510-10|AAC46780.1| 979|Caenorhabditis elegans Hypothetical protein R12C12.1a protein. Length = 979 Score = 27.1 bits (57), Expect = 10.0 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -1 Query: 399 SPLTATEEALSLGRVRSTLNFDLKMLKVTSLTTT 298 S T + +S GR+ S LNF + ++T L TT Sbjct: 126 SQYTPYQAEISQGRLESLLNFQTMIAEMTGLPTT 159 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,051,418 Number of Sequences: 27780 Number of extensions: 236000 Number of successful extensions: 605 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 605 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1247656244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -