Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fe100P06_F_M03
         (654 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF263514-1|AAF74206.1|  127|Tribolium castaneum cytochrome P450 ...    25   0.72 
AM292365-1|CAL23177.1|  313|Tribolium castaneum gustatory recept...    22   5.1  
AM292325-1|CAL23137.2|  309|Tribolium castaneum gustatory recept...    22   5.1  

>AF263514-1|AAF74206.1|  127|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 127

 Score = 24.6 bits (51), Expect = 0.72
 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 2/47 (4%)
 Frame = +3

Query: 438 PVPL--KYLNERVSMYMHAYTLYSAVRPYGCSVVMGTWTDYEGPQMY 572
           PVP+  + LN+ + +    YT+     P GC+VV+GT+  +   + Y
Sbjct: 61  PVPIIARQLNQDLKLASGDYTV-----PAGCTVVIGTFKVHRLEEYY 102


>AM292365-1|CAL23177.1|  313|Tribolium castaneum gustatory receptor
           candidate 44 protein.
          Length = 313

 Score = 21.8 bits (44), Expect = 5.1
 Identities = 8/12 (66%), Positives = 11/12 (91%)
 Frame = +2

Query: 62  WTNISVFVLVEI 97
           WT++SV+ LVEI
Sbjct: 198 WTSLSVYHLVEI 209


>AM292325-1|CAL23137.2|  309|Tribolium castaneum gustatory receptor
           candidate 4 protein.
          Length = 309

 Score = 21.8 bits (44), Expect = 5.1
 Identities = 8/12 (66%), Positives = 11/12 (91%)
 Frame = +2

Query: 62  WTNISVFVLVEI 97
           WT++SV+ LVEI
Sbjct: 194 WTSLSVYHLVEI 205


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 169,597
Number of Sequences: 336
Number of extensions: 3894
Number of successful extensions: 6
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16865010
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)