BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fe100P05_F_M09
(364 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_A1W545 Cluster: Periplasmic copper-binding precursor; n... 31 6.3
>UniRef50_A1W545 Cluster: Periplasmic copper-binding precursor;
n=22; Betaproteobacteria|Rep: Periplasmic copper-binding
precursor - Acidovorax sp. (strain JS42)
Length = 423
Score = 31.1 bits (67), Expect = 6.3
Identities = 13/33 (39%), Positives = 20/33 (60%)
Frame = -3
Query: 113 EDDKYFNRFTVRLPCTSVRQIRNDRTWINSDFG 15
++D Y+NR + L + +RN+R W NSD G
Sbjct: 219 DNDTYYNRGGLALMEVREQTVRNNRAWGNSDHG 251
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 210,842,679
Number of Sequences: 1657284
Number of extensions: 2638803
Number of successful extensions: 4046
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4010
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4046
length of database: 575,637,011
effective HSP length: 90
effective length of database: 426,481,451
effective search space used: 12794443530
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -