BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_F03 (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 28 0.30 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 26 1.2 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 25 1.6 Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precurso... 23 6.4 AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylch... 23 6.4 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 27.9 bits (59), Expect = 0.30 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = -1 Query: 407 DHIA--PSEREVPCRPTFVRPSCPGLLQRHDARKTSRRRIL 291 DH++ P REV R + + LL+ H KTS+ R+L Sbjct: 806 DHLSWLPHVREVTTRARKIADAVTRLLRNHSGPKTSKARLL 846 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 25.8 bits (54), Expect = 1.2 Identities = 13/41 (31%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -1 Query: 515 DCANGCGYDCASNYDGGN--ETWTCACDRNDSCMAMRGDHI 399 D + C N GG + C C N +CM M GD + Sbjct: 752 DTCDQCAKGYYGNALGGTPYDCKRCPCPNNGACMQMAGDTV 792 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 25.4 bits (53), Expect = 1.6 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +2 Query: 143 PPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIP 265 PPP+ + + + L + T E V ++C E G I+ P Sbjct: 756 PPPKPPTVTMMDMQQLDTQPTLEFKELVSQKCAERGIIFAP 796 >Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precursor of ANTRYP7 protein. Length = 267 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -2 Query: 376 PAVQHSSVHRVQGFFSVTTLEKPHE 302 P H S HR+ G F + + P++ Sbjct: 32 PRSPHGSGHRIVGGFEINVSDTPYQ 56 >AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 2 protein. Length = 569 Score = 23.4 bits (48), Expect = 6.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +1 Query: 127 NELRKTSATNRWHGLV 174 N L T+ATNR+ GLV Sbjct: 426 NGLHSTTATNRFSGLV 441 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 532,873 Number of Sequences: 2352 Number of extensions: 10073 Number of successful extensions: 25 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -