BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_F01 (654 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 24 1.5 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 24 1.5 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 24 1.5 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 24 1.5 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 23 3.4 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 23 3.4 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 7.9 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 23.8 bits (49), Expect = 1.5 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +3 Query: 537 EFLKHSQVYELYPNKF 584 +++K +YE+YPN F Sbjct: 155 KYMKFPAIYEIYPNYF 170 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 23.8 bits (49), Expect = 1.5 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +3 Query: 537 EFLKHSQVYELYPNKF 584 +++K +YE+YPN F Sbjct: 155 KYMKFPAIYEIYPNYF 170 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.5 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 5/54 (9%) Frame = -2 Query: 491 SKFPYXVSNQRPLTGN---EGSYSNSNISLGYPLTTNLSLVKL--NPNVSYCGD 345 SK P +SN PL+ N +Y+N N L N++ ++ P YCG+ Sbjct: 76 SKEPKIISNNNPLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQIPIPVPVYCGN 129 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +2 Query: 170 NLKWMFVRKTSA*LFKIKILCPRNTIVVLNTEFSLT 277 N KW F + + K+ CP +T ++ EFS++ Sbjct: 214 NSKWDFKVIKATKVLKMYACCPNDTYPMIVYEFSIS 249 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -3 Query: 592 SLRNLFGYNSYTCECFKNSNPC 527 S G ++ EC K SNPC Sbjct: 86 SCNKCIGCSAEKFECSKTSNPC 107 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 483 KFAQVDAYGNXLVCVHGFEFLKHSQVYEL 569 K Q + Y N L FLKHS + ++ Sbjct: 94 KIIQTEKYSNMLNSEKHASFLKHSNIVKV 122 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/37 (27%), Positives = 16/37 (43%) Frame = +1 Query: 340 YKSPQYETLGFNLTKERLVVKGYPREILEFEYDPSFP 450 Y +PQ + L +++ GY + YDP P Sbjct: 110 YGNPQQQQLAAETQQQQQHNNGYASPMSTSSYDPYSP 146 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,031 Number of Sequences: 438 Number of extensions: 4450 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -