BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_E21 (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 23 6.4 AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. 23 8.4 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 23.4 bits (48), Expect = 6.4 Identities = 15/67 (22%), Positives = 29/67 (43%) Frame = -2 Query: 631 SVVFAHAARIHLKSLQIIQSRFCRIAVGAPWFVRNVDLHDDLDLESISKYLQSASMRHFD 452 S V H+ R + ++S ++ G + R+ + D K+ + S RH D Sbjct: 576 SFVVEHSRRDRDRDRDRMRSDSGKVGGGGGGYDRDDYRRTEKDYRGNGKHDKYGSSRHSD 635 Query: 451 KAARHEN 431 ++RH + Sbjct: 636 SSSRHRS 642 >AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. Length = 194 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = +3 Query: 531 LTNHGAPTAILQKRD*IICKDFKC 602 +T+H + T ++ ++ + CK FKC Sbjct: 166 MTDHESATMEIRLKEPVDCKCFKC 189 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 566,850 Number of Sequences: 2352 Number of extensions: 10779 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -