BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_E04 (582 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochr... 25 0.62 DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory pro... 23 1.4 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 23 2.5 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 3.3 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 22 3.3 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 5.8 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 7.6 DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 prot... 21 7.6 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 21 7.6 AF264720-1|AAF75272.1| 126|Tribolium castaneum putative cytochr... 21 7.6 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 21 7.6 >AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q2 protein. Length = 126 Score = 24.6 bits (51), Expect = 0.62 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +1 Query: 286 RXALGDANGKAKEALEQSRQNIERTAEELRKAHPDVEKNATALREKLQ 429 R LGD + K + Q+ + +ER +E + +P V + AL E ++ Sbjct: 27 RDVLGDIHAKPTYSDLQNLKYLERCIKESLRLYPSVHLISRALGEDVR 74 >DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory protein 19 protein. Length = 119 Score = 23.4 bits (48), Expect = 1.4 Identities = 10/52 (19%), Positives = 26/52 (50%) Frame = +1 Query: 385 PDVEKNATALREKLQAAVQNTVQESQKLAKKVSSNVQETNEKLAPKIKAAYD 540 PD ++ L + L++ ++ +++ KKV + +++ ++ A YD Sbjct: 53 PDADELKRVLPDALKSDCAKCSEKQKEMTKKVIHFLSHNKQQMWKELTAKYD 104 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 22.6 bits (46), Expect = 2.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -3 Query: 217 KSCASFDLVSELNCCSKVLWNXLGVVFDVLEEVGSVASH 101 KS A+FD V+ + +LW DV+E+ S A + Sbjct: 418 KSLAAFDFVARNSDTPIILWTSHLTQADVIEKYLSKARY 456 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 22.2 bits (45), Expect = 3.3 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -2 Query: 428 CSFSRRAVAFFSTSGWALRSSSAVRSMFCLDCSK 327 C ++ A ST LR+ S + C+DC+K Sbjct: 252 CRICGKSYARPSTLKTHLRTHSGEKPYRCIDCNK 285 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 22.2 bits (45), Expect = 3.3 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 104 RRDAPDFFKDIEH 142 RR AP F+DI+H Sbjct: 84 RRKAPQSFEDIQH 96 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/28 (32%), Positives = 12/28 (42%) Frame = -3 Query: 373 GAPRPCARCSASTVPKPPWPCRSRLRAL 290 G P+P + CS + P C L L Sbjct: 1271 GGPQPYSACSENAFAAYPGDCTRYLHCL 1298 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.0 bits (42), Expect = 7.6 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -3 Query: 208 ASFDLVSELNCCSKVLWNXL 149 A D SE++C S+ +W+ L Sbjct: 102 ALLDTGSEVSCISEEVWSKL 121 >DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 protein. Length = 383 Score = 21.0 bits (42), Expect = 7.6 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 471 EEGVLERAGD**ETGAQDQGRLRRLREEHP 560 ++GV+ D TG + L LRE++P Sbjct: 62 DDGVVSVLDDWEITGLDEMNHLMSLREKNP 91 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.0 bits (42), Expect = 7.6 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +1 Query: 295 LGDANGKAKEALEQSRQNIERTAEELRKAHPDVEKNATALREKL 426 LGD K Q + +ER +E+ + +P V + L E L Sbjct: 346 LGDIKKKPTYQDLQEMKYLERCVKEVLRLYPSVHFISRKLGEDL 389 >AF264720-1|AAF75272.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q1 protein. Length = 126 Score = 21.0 bits (42), Expect = 7.6 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +1 Query: 286 RXALGDANGKAKEALEQSRQNIERTAEELRKAHPDVEKNATALREKL 426 R LGD + K Q+ + +ER +E + +P V + L + L Sbjct: 27 REVLGDLSKKPSYNDLQNLKYLERCIKETLRLYPSVHFISRTLGQDL 73 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.0 bits (42), Expect = 7.6 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +1 Query: 295 LGDANGKAKEALEQSRQNIERTAEELRKAHPDVEKNATALREKL 426 LGD K Q + +ER +E+ + +P V + L E L Sbjct: 346 LGDIKKKPTYQDLQEMKYLERCVKEVLRLYPSVHFISRKLGEDL 389 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.315 0.125 0.336 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,948 Number of Sequences: 336 Number of extensions: 1475 Number of successful extensions: 12 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14517299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -