BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fe100P05_F_D19
(652 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
04_03_0582 + 17528335-17529790,17529913-17531651,17531814-175320... 27 9.8
>04_03_0582 + 17528335-17529790,17529913-17531651,17531814-17532035,
17532062-17533525
Length = 1626
Score = 27.5 bits (58), Expect = 9.8
Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 1/46 (2%)
Frame = +3
Query: 471 PLTLRTDLKSLGLCDEKADVIVKVWSSETRPILDQF-SKETSGMSQ 605
P+ L+ D + + LC+ V+ K + RPILD SKE S Q
Sbjct: 961 PIDLK-DYRPISLCNVVYKVVSKCLVNRLRPILDDLVSKEQSAFIQ 1005
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,156,346
Number of Sequences: 37544
Number of extensions: 210606
Number of successful extensions: 455
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 445
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 455
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1620349964
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -