BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_D14 (653 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 1.9 M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-... 23 2.6 L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 21 7.9 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.4 bits (48), Expect = 1.9 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = -3 Query: 636 NYLIAFYKQNTSCS*R*FQLSLNVNQNQCQMHFIQTLES 520 N L+ F + + R +LSL N C+ F+Q L S Sbjct: 900 NRLVTFPVWQVTLNARLVELSLGSNPWSCRCKFLQELSS 938 >M29492-1|AAA27727.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H40. ). Length = 74 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 127 LWLNSAREQIKSENPGLRV 183 +W + R + K +NPGL V Sbjct: 54 IWFQNRRTKWKKQNPGLDV 72 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 Query: 309 RWWRRGRKEGSKTREKG 359 RWW R R+ T + G Sbjct: 44 RWWSRPREPAQTTSKAG 60 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,583 Number of Sequences: 438 Number of extensions: 2691 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -