BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_D08 (652 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16903| Best HMM Match : No HMM Matches (HMM E-Value=.) 180 7e-46 SB_55500| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=2.8e-24) 83 3e-16 SB_38307| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=1.6e-27) 41 8e-04 SB_235| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=3.9e-15) 37 0.012 SB_46996| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_57776| Best HMM Match : EB (HMM E-Value=2.9) 29 4.3 SB_48160| Best HMM Match : Cytochrom_C (HMM E-Value=1.8e-05) 28 5.7 SB_35585| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_19395| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_16903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 180 bits (439), Expect = 7e-46 Identities = 84/147 (57%), Positives = 102/147 (69%) Frame = +2 Query: 212 NPLFEKRPKNFAIGQGIQPTRDLSRFVRWPKYIRIQRQKAVLQRRLKVPPPINQFTQTLD 391 NPL EKRP+NF IG IQP RDLSRFVRWP+Y+++QRQK++L +RLKVPP INQFTQ LD Sbjct: 29 NPLIEKRPRNFGIGGDIQPKRDLSRFVRWPRYVKLQRQKSLLYQRLKVPPAINQFTQALD 88 Query: 392 KTTAKGLFKILEKYRPETXXXXXXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNTVTKLVE 571 + + LFK+L KYRPET +P ++ G N +T LVE Sbjct: 89 RQSTVQLFKLLHKYRPETKAEKKARLSAKAEKKAEGKEEAPGKKPMLVKYGINHITSLVE 148 Query: 572 KKKAQLVVIAHDVDPIELVLFLPALCR 652 KKAQLVVIAHDVDPIE+V++LPALCR Sbjct: 149 NKKAQLVVIAHDVDPIEIVVWLPALCR 175 >SB_55500| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=2.8e-24) Length = 172 Score = 82.6 bits (195), Expect = 3e-16 Identities = 40/81 (49%), Positives = 48/81 (59%) Frame = +2 Query: 410 LFKILEKYRPETXXXXXXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNTVTKLVEKKKAQL 589 LFK+L KYRPET +P ++ G N +T LVE KKAQL Sbjct: 4 LFKLLHKYRPETKAEKKARLSAKAEKKAEGKEEAPGKKPMLVKYGINHITSLVENKKAQL 63 Query: 590 VVIAHDVDPIELVLFLPALCR 652 VVIAHDVDPIE+V++LPALCR Sbjct: 64 VVIAHDVDPIEIVVWLPALCR 84 >SB_38307| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=1.6e-27) Length = 187 Score = 41.1 bits (92), Expect = 8e-04 Identities = 16/39 (41%), Positives = 26/39 (66%) Frame = +2 Query: 533 IRSGTNTVTKLVEKKKAQLVVIAHDVDPIELVLFLPALC 649 +R G N TK + + A+ +V+A D +P+E++L LP LC Sbjct: 94 LRKGANEATKCLNRGIAEFIVMAADTEPLEILLHLPLLC 132 >SB_235| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=3.9e-15) Length = 544 Score = 37.1 bits (82), Expect = 0.012 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +2 Query: 521 RPNTIRSGTNTVTKLVEKKKAQLVVIAHDVDPIELVLFLPALC 649 + T+R G V K + K + V++A DV PI+++ +P +C Sbjct: 95 KAKTLRRGVKEVVKALRKGEKGFVILAGDVSPIDVISHIPVMC 137 >SB_46996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/58 (25%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +1 Query: 205 DRESSLREEAKELCYWSGHSANS*LVQ-ICKMAQVYPHPAPEGCTSASSESAPSDQPI 375 DR ++ E KE+CYW GH + + + + + + T+++SE S +P+ Sbjct: 137 DRRKNMEERHKEMCYW-GHKFETYVTKLVSERGKRETVMGASTSTASTSEGGASAKPV 193 >SB_57776| Best HMM Match : EB (HMM E-Value=2.9) Length = 669 Score = 28.7 bits (61), Expect = 4.3 Identities = 15/58 (25%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +1 Query: 205 DRESSLREEAKELCYWSGHSANS*LVQ-ICKMAQVYPHPAPEGCTSASSESAPSDQPI 375 DR ++ E KE+CYW GH + + + + + + T++ SE S +P+ Sbjct: 187 DRRKNMEERHKEMCYW-GHKFETYVTKLVSERGKRETVMGASTSTASKSEGGASAKPV 243 >SB_48160| Best HMM Match : Cytochrom_C (HMM E-Value=1.8e-05) Length = 212 Score = 28.3 bits (60), Expect = 5.7 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 Query: 523 PLWWRLIFLGNLSFSSFPQPLFPG 452 P WW ++F+G + FS L+PG Sbjct: 56 PKWWFMLFIGTIVFSIGYLVLYPG 79 >SB_35585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +1 Query: 334 TSASSESAPSDQPIYPDTG 390 T+ASSE+APS P PD G Sbjct: 43 TAASSEAAPSSAPSMPDYG 61 >SB_19395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 832 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = +2 Query: 281 SRFVRWPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEK 430 SR RW Y R+ KA+LQR ++ I Q T + K +L K Sbjct: 508 SRTFRWDPYSRMSTLKALLQRMEQLKTQIVQETCEIKKLEKLSRLVLLRK 557 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,278,291 Number of Sequences: 59808 Number of extensions: 284565 Number of successful extensions: 797 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 795 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -