BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_C22 (415 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6453| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_44750| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_27410| Best HMM Match : Peptidase_A24 (HMM E-Value=9.3) 27 6.1 SB_19630| Best HMM Match : Peptidase_A24 (HMM E-Value=9.3) 27 6.1 >SB_6453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 784 Score = 28.7 bits (61), Expect = 2.0 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 Query: 351 LRTNNTGNIFSFRFTPC 301 + T +TGNIFS +F PC Sbjct: 51 IATGHTGNIFSIKFLPC 67 >SB_44750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2190 Score = 27.5 bits (58), Expect = 4.6 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 326 YLVSGLLLAYKLHSWVVR 273 Y V G+LL YK++ W VR Sbjct: 1244 YYVHGILLGYKVYYWAVR 1261 >SB_27410| Best HMM Match : Peptidase_A24 (HMM E-Value=9.3) Length = 156 Score = 27.1 bits (57), Expect = 6.1 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 329 IYLVSGLLLAYKLHSWVVRPHHHIGTLVPSIVSIVLHVIV 210 I++V+ +++ Y H H H+ +V +IV ++ VIV Sbjct: 80 IFIVAIVIVMYHRHCHCCHRHRHVIVIVIAIVIVIAIVIV 119 >SB_19630| Best HMM Match : Peptidase_A24 (HMM E-Value=9.3) Length = 128 Score = 27.1 bits (57), Expect = 6.1 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 329 IYLVSGLLLAYKLHSWVVRPHHHIGTLVPSIVSIVLHVIV 210 I++V+ +++ Y H H H+ +V +IV ++ VIV Sbjct: 52 IFIVAIVIVMYHRHCHCCHRHRHVIVIVIAIVIVIAIVIV 91 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,961,364 Number of Sequences: 59808 Number of extensions: 191509 Number of successful extensions: 428 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 416 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 427 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 764823134 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -