BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_C21 (651 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 25 0.48 DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. 22 4.5 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 5.9 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 5.9 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 25.4 bits (53), Expect = 0.48 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = +2 Query: 542 LCYEDCMAVKMQFCYNDWIVIEDQKERGVFFESRG 646 +C + +QFC+N IV D K + + G Sbjct: 158 ICILKSITCALQFCHNAGIVHADVKPKNILMSKNG 192 >DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. Length = 132 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +2 Query: 545 CYEDCMAVKMQFCYNDWIVIEDQ-KERGVFFES 640 CY DCM K+ F D E++ +ER +S Sbjct: 61 CYVDCMLKKVGFVNADTTFNEEKFRERTTKLDS 93 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 330 TMGKYVKVILPATY 371 T GKY + I+PA Y Sbjct: 192 TSGKYKEYIIPANY 205 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 330 TMGKYVKVILPATY 371 T GKY + I+PA Y Sbjct: 192 TSGKYKEYIIPANY 205 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,924 Number of Sequences: 438 Number of extensions: 4024 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -