BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_C20 (650 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46477| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_32646| Best HMM Match : IQ (HMM E-Value=8.5e-07) 28 5.7 >SB_46477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6116 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +3 Query: 300 LSESQG-ISPALFARSLLQGVFSDSTISKKYIKDTTLIDNKDLAYQVFMG 446 +SE +G PAL++ + + +++ I DT L N L+Y++ G Sbjct: 4769 ISEGKGEFVPALYSADISEATAAETAIINVTCSDTDLGPNSQLSYEIIRG 4818 >SB_32646| Best HMM Match : IQ (HMM E-Value=8.5e-07) Length = 465 Score = 28.3 bits (60), Expect = 5.7 Identities = 18/61 (29%), Positives = 29/61 (47%) Frame = +3 Query: 228 ISSKYQELYEVAMRDDTKENVILKLSESQGISPALFARSLLQGVFSDSTISKKYIKDTTL 407 ISSK + L + + D+ + E Q + +AR L G+ S S K I++TT Sbjct: 251 ISSKSERLEALKDKKDSADARTAAAIEVQRVWRGYYARCKLFGILHPSVSSMKTIEETTF 310 Query: 408 I 410 + Sbjct: 311 L 311 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,314,583 Number of Sequences: 59808 Number of extensions: 260146 Number of successful extensions: 577 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 577 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -