BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_C09 (652 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U13616-1|AAA64834.1| 4377|Homo sapiens ankyrin G protein. 32 2.0 AL592430-3|CAI40518.1| 4372|Homo sapiens ankyrin 3, node of Ranv... 32 2.0 AL359377-2|CAI41373.1| 4372|Homo sapiens ankyrin 3, node of Ranv... 32 2.0 AL359267-1|CAH73232.1| 4372|Homo sapiens ankyrin 3, node of Ranv... 32 2.0 >U13616-1|AAA64834.1| 4377|Homo sapiens ankyrin G protein. Length = 4377 Score = 31.9 bits (69), Expect = 2.0 Identities = 25/65 (38%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = +2 Query: 173 KNIEKPIQQ---TTVYGHF*KTINEAYRVF*LKKMPKIPYKPEKSGGNDDDYEIVSFDDF 343 K EK IQQ + KT+ E F + K P P+ S DD E VSF D Sbjct: 3103 KQYEKEIQQGGVKKIISQECKTVQETRGTFYTTRQQKQPPSPQGSP-EDDTLEQVSFLDS 3161 Query: 344 SDKSP 358 S KSP Sbjct: 3162 SGKSP 3166 >AL592430-3|CAI40518.1| 4372|Homo sapiens ankyrin 3, node of Ranvier (ankyrin G) protein. Length = 4372 Score = 31.9 bits (69), Expect = 2.0 Identities = 25/65 (38%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = +2 Query: 173 KNIEKPIQQ---TTVYGHF*KTINEAYRVF*LKKMPKIPYKPEKSGGNDDDYEIVSFDDF 343 K EK IQQ + KT+ E F + K P P+ S DD E VSF D Sbjct: 3098 KQYEKEIQQGGVKKIISQECKTVQETRGTFYTTRQQKQPPSPQGSP-EDDTLEQVSFLDS 3156 Query: 344 SDKSP 358 S KSP Sbjct: 3157 SGKSP 3161 >AL359377-2|CAI41373.1| 4372|Homo sapiens ankyrin 3, node of Ranvier (ankyrin G) protein. Length = 4372 Score = 31.9 bits (69), Expect = 2.0 Identities = 25/65 (38%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = +2 Query: 173 KNIEKPIQQ---TTVYGHF*KTINEAYRVF*LKKMPKIPYKPEKSGGNDDDYEIVSFDDF 343 K EK IQQ + KT+ E F + K P P+ S DD E VSF D Sbjct: 3098 KQYEKEIQQGGVKKIISQECKTVQETRGTFYTTRQQKQPPSPQGSP-EDDTLEQVSFLDS 3156 Query: 344 SDKSP 358 S KSP Sbjct: 3157 SGKSP 3161 >AL359267-1|CAH73232.1| 4372|Homo sapiens ankyrin 3, node of Ranvier (ankyrin G) protein. Length = 4372 Score = 31.9 bits (69), Expect = 2.0 Identities = 25/65 (38%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = +2 Query: 173 KNIEKPIQQ---TTVYGHF*KTINEAYRVF*LKKMPKIPYKPEKSGGNDDDYEIVSFDDF 343 K EK IQQ + KT+ E F + K P P+ S DD E VSF D Sbjct: 3098 KQYEKEIQQGGVKKIISQECKTVQETRGTFYTTRQQKQPPSPQGSP-EDDTLEQVSFLDS 3156 Query: 344 SDKSP 358 S KSP Sbjct: 3157 SGKSP 3161 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,713,475 Number of Sequences: 237096 Number of extensions: 1565840 Number of successful extensions: 3103 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3000 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3103 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7253890590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -