BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_B20 (639 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 3.5 DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. 23 6.2 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 23 6.2 AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 23 8.2 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 24.2 bits (50), Expect = 3.5 Identities = 13/62 (20%), Positives = 30/62 (48%) Frame = +1 Query: 292 RGAKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVL 471 R A + LE + +++L +N + NF FG+ L ++++ + + ++ Y V Sbjct: 3256 RIAALSDELEESRHILQHKLYSNNSQSLNNFKFGLHTQEILPLQFNKASSMATINEYRVC 3315 Query: 472 GR 477 + Sbjct: 3316 SK 3317 >DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. Length = 418 Score = 23.4 bits (48), Expect = 6.2 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -1 Query: 612 LLCXAIKYDTIIFLLEPLHSIFLCEAVGKSHFSCLTPSVCYVETWPAKYDV 460 L+ I YDT + LL+ HSI + ++ T SV + +T A ++ Sbjct: 123 LITDRIFYDTTVTLLQKYHSII------AARYNATTQSVDFQDTQSAAAEI 167 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 23.4 bits (48), Expect = 6.2 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +1 Query: 472 GRPGFNVAHRRRKTGKVGFP 531 G+PG+ + ++ G GFP Sbjct: 498 GQPGYGIPGQKGNAGMAGFP 517 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 23.0 bits (47), Expect = 8.2 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = -1 Query: 333 FQTPLKDFFCFSSSDCTMDSNLFITTDTKRPHCIPSLGKYRLLSCE 196 + TP F++ S++ TT T P +G+Y L S E Sbjct: 134 YSTPQISMVNFTNRIGDETSSILTTTHTSVPKMCAKIGEYCLTSSE 179 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 675,636 Number of Sequences: 2352 Number of extensions: 13847 Number of successful extensions: 24 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -