BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_B14 (459 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like prote... 22 2.4 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 22 2.4 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 7.3 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 20 9.6 >AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like protein protein. Length = 160 Score = 22.2 bits (45), Expect = 2.4 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = -3 Query: 427 RFLSPWFL*HVGTMRL 380 ++ SPWF H+G +++ Sbjct: 137 QYFSPWFAEHMGQIKV 152 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 22.2 bits (45), Expect = 2.4 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 211 IQLILTSEESFIKHDKAEICFRASANMHSVRD 306 ++ + T EE+ ++ DKA RA A HS D Sbjct: 95 LESLATVEETVVR-DKAVESLRAVAQQHSPAD 125 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 20.6 bits (41), Expect = 7.3 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -3 Query: 205 FYYSNLVTRDIYLFF*RFRILKKNLM 128 FYY+ ++ +Y F+ F I +L+ Sbjct: 103 FYYAFIILLCVYYFYYAFIIFTVHLL 128 Score = 20.2 bits (40), Expect = 9.6 Identities = 7/24 (29%), Positives = 16/24 (66%) Frame = +1 Query: 256 KAEICFRASANMHSVRDDSSGAAV 327 K C ++ ++HS+++ SGA++ Sbjct: 15 KKRKCTVSNVSLHSLKNKRSGASL 38 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 20.2 bits (40), Expect = 9.6 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +3 Query: 384 RIVPTCYRNQGLKNLDGIW 440 ++VP CY N + + G W Sbjct: 214 QVVPYCYINCLIYLIGGFW 232 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,640 Number of Sequences: 336 Number of extensions: 2066 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10511300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -