BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_B14 (459 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g29650.3 68415.m03602 inorganic phosphate transporter, putati... 29 2.0 At2g29650.1 68415.m03603 inorganic phosphate transporter, putati... 29 2.0 At3g58560.1 68416.m06527 endonuclease/exonuclease/phosphatase fa... 28 3.5 At4g00370.1 68417.m00051 sugar transporter family protein contai... 27 6.1 At5g55530.3 68418.m06918 C2 domain-containing protein low simila... 27 8.1 At5g55530.2 68418.m06917 C2 domain-containing protein low simila... 27 8.1 At5g55530.1 68418.m06916 C2 domain-containing protein low simila... 27 8.1 At4g17585.1 68417.m02629 hypothetical protein 27 8.1 >At2g29650.3 68415.m03602 inorganic phosphate transporter, putative similar to brain specific Na+-dependent inorganic phosphate cotransporter [Rattus norvegicus] GI:507415; contains Pfam profile PF00083: major facilitator superfamily protein Length = 400 Score = 28.7 bits (61), Expect = 2.0 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 1/81 (1%) Frame = -1 Query: 408 FCSTWVQCASVAW*FSLYNWLISFELDDSGTTAIVT-DTMHISRSAKANLGFIMFNKTFL 232 FC W + W + Y+ ++ F L +SG ++ TM IS +A + + ++ F Sbjct: 219 FCHNWGTFILLTWMPTYYHQVLKFNLMESGLLSVFPWMTMAISANAGGWIADTLVSRGFS 278 Query: 231 ASEN*LNLNFTIRI*SPAIFI 169 + N + TI PA F+ Sbjct: 279 VT-NVRKIMQTIGFLGPAFFL 298 >At2g29650.1 68415.m03603 inorganic phosphate transporter, putative similar to brain specific Na+-dependent inorganic phosphate cotransporter [Rattus norvegicus] GI:507415; contains Pfam profile PF00083: major facilitator superfamily protein Length = 512 Score = 28.7 bits (61), Expect = 2.0 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 1/81 (1%) Frame = -1 Query: 408 FCSTWVQCASVAW*FSLYNWLISFELDDSGTTAIVT-DTMHISRSAKANLGFIMFNKTFL 232 FC W + W + Y+ ++ F L +SG ++ TM IS +A + + ++ F Sbjct: 331 FCHNWGTFILLTWMPTYYHQVLKFNLMESGLLSVFPWMTMAISANAGGWIADTLVSRGFS 390 Query: 231 ASEN*LNLNFTIRI*SPAIFI 169 + N + TI PA F+ Sbjct: 391 VT-NVRKIMQTIGFLGPAFFL 410 >At3g58560.1 68416.m06527 endonuclease/exonuclease/phosphatase family protein similar to SP|P31384 Glucose-repressible alcohol dehydrogenase transcriptional effector (Carbon catabolite repressor protein 4) {Saccharomyces cerevisiae}; contains Pfam profile PF03372: Endonuclease/Exonuclease/phosphatase family Length = 602 Score = 27.9 bits (59), Expect = 3.5 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +2 Query: 299 SVTIAVVPLSSSSNEINQLYKEN 367 S+T A++P+S N +N+L K+N Sbjct: 365 SLTEAIIPVSQKKNALNRLVKDN 387 >At4g00370.1 68417.m00051 sugar transporter family protein contains Pfam profile PF00083: major facilitator superfamily protein Length = 541 Score = 27.1 bits (57), Expect = 6.1 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -1 Query: 408 FCSTWVQCASVAW*FSLYNWLISFELDDSGTTAIV 304 FC W + W + YN ++ F L +SG ++ Sbjct: 360 FCHNWGTFILLTWMPTYYNQVLKFNLTESGLLCVL 394 >At5g55530.3 68418.m06918 C2 domain-containing protein low similarity to cold-regulated gene SRC2 [Glycine max] GI:2055230; contains Pfam profile PF00168: C2 domain Length = 405 Score = 26.6 bits (56), Expect = 8.1 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -3 Query: 133 LMHKIK*NSFQQDLGALIVIIFDMLFSNSKLEYAFS 26 +M ++K Q LG +V + ++LF N KLE FS Sbjct: 123 MMSRVKNYLEDQLLGFTLVPMSELLFKNGKLEKEFS 158 >At5g55530.2 68418.m06917 C2 domain-containing protein low similarity to cold-regulated gene SRC2 [Glycine max] GI:2055230; contains Pfam profile PF00168: C2 domain Length = 405 Score = 26.6 bits (56), Expect = 8.1 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -3 Query: 133 LMHKIK*NSFQQDLGALIVIIFDMLFSNSKLEYAFS 26 +M ++K Q LG +V + ++LF N KLE FS Sbjct: 123 MMSRVKNYLEDQLLGFTLVPMSELLFKNGKLEKEFS 158 >At5g55530.1 68418.m06916 C2 domain-containing protein low similarity to cold-regulated gene SRC2 [Glycine max] GI:2055230; contains Pfam profile PF00168: C2 domain Length = 405 Score = 26.6 bits (56), Expect = 8.1 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -3 Query: 133 LMHKIK*NSFQQDLGALIVIIFDMLFSNSKLEYAFS 26 +M ++K Q LG +V + ++LF N KLE FS Sbjct: 123 MMSRVKNYLEDQLLGFTLVPMSELLFKNGKLEKEFS 158 >At4g17585.1 68417.m02629 hypothetical protein Length = 152 Score = 26.6 bits (56), Expect = 8.1 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 119 KIKQFPTRSWRAYRNNIRYVIFEFEIG 39 KIK+ P R W + + R VI F++G Sbjct: 29 KIKKIPKRLWSVGKEDPRRVIHAFKVG 55 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,156,249 Number of Sequences: 28952 Number of extensions: 165227 Number of successful extensions: 393 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 387 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 393 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 762235320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -