BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_B12 (652 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2C4.06c |||rRNA methyltransferase |Schizosaccharomyces pombe... 27 2.3 SPAP32A8.02 |||xylose and arabinose reductase |Schizosaccharomyc... 27 3.1 SPAC2G11.03c |vps45||vacuolar sorting protein Vps 45|Schizosacch... 26 4.1 SPBC20F10.07 |||GRAM domain protein|Schizosaccharomyces pombe|ch... 26 5.4 SPBC2F12.12c |||conserved eukaryotic protein|Schizosaccharomyces... 25 9.5 >SPAC2C4.06c |||rRNA methyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 455 Score = 27.1 bits (57), Expect = 2.3 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 103 YKIAANILKKVSTEGGSVKTLLYDDK 180 Y AANIL +S + GS+K L ++ K Sbjct: 4 YNHAANILSDLSKKKGSIKQLAFNSK 29 >SPAP32A8.02 |||xylose and arabinose reductase |Schizosaccharomyces pombe|chr 1|||Manual Length = 283 Score = 26.6 bits (56), Expect = 3.1 Identities = 21/74 (28%), Positives = 34/74 (45%) Frame = +3 Query: 159 DFVIRR*TPSLH*LRMADGDEGPLIPIQTKLAVIVLAKLFVYSVAMFTLPFVAFFGVHYL 338 D I +P H +R+ D L+PI KL + V L +S+ +P + ++ Sbjct: 189 DIAIEAYSPLTHGIRLNDEK---LVPIAKKLNISVAQLLIRWSLQKGYIPIIKSTKKEHM 245 Query: 339 LSDYYHLETFVVTV 380 LSD L+ F T+ Sbjct: 246 LSD---LDVFNFTI 256 >SPAC2G11.03c |vps45||vacuolar sorting protein Vps 45|Schizosaccharomyces pombe|chr 1|||Manual Length = 558 Score = 26.2 bits (55), Expect = 4.1 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -2 Query: 543 VSSLRSFFRTLLDWECMNADQSRFHVHHILSHDKPD 436 V S++ FF LD+ +N D + F++ HI+ D PD Sbjct: 117 VKSIQEFF---LDYLVVNNDLASFNIPHII-EDSPD 148 >SPBC20F10.07 |||GRAM domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 764 Score = 25.8 bits (54), Expect = 5.4 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +1 Query: 271 NYLSIVWLCSHYHLLHFLVF-TTYSLIITIWKH 366 N + I L + Y F+ TTY LII IWK+ Sbjct: 271 NAIQITTLHARYIFASFISRDTTYQLIIAIWKN 303 >SPBC2F12.12c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 517 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = +3 Query: 447 HEKEYDEHGNEIDQHSYTPSQVESEKSSLNLKQD 548 +EKE ++H N + +Y P + ++K L ++ Sbjct: 304 YEKELNDHVNIVKSSTYIPISIPTQKQKPTLPKN 337 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,430,683 Number of Sequences: 5004 Number of extensions: 45019 Number of successful extensions: 94 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 94 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -