BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_B12 (652 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 23 6.3 DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 23 8.4 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 273 LFVYSVAMFTLPFVAFFGVHYLLSDYYHLET 365 LFV +++F F+ + LLS +Y L T Sbjct: 297 LFVIKISLFRTVFLRLSSLAVLLSRFYFLIT 327 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/52 (23%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = +3 Query: 228 LIPIQTKLAVIVLAKLFVYSVAMFTLPFVAFFGVHYLLSDYYHL--ETFVVT 377 L+PI L+V + V + +P+ + Y++ Y+++ ET +T Sbjct: 135 LLPILCSLSVAITHVTMVDFKLLQVIPYCVLDTITYMMGGYWYMACETLSIT 186 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 603,053 Number of Sequences: 2352 Number of extensions: 11508 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -