BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_B12 (652 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 4.5 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 22 4.5 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 4.5 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 22 4.5 AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc fi... 22 4.5 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 7.8 AM158085-1|CAJ43389.1| 171|Apis mellifera globin 1 protein. 21 7.8 AM158084-1|CAJ43388.1| 171|Apis mellifera globin 1 protein. 21 7.8 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 22.2 bits (45), Expect = 4.5 Identities = 11/30 (36%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = +3 Query: 456 EYDEHGNEID-QHSYTPSQVESEKSSLNLK 542 +YDE G+E+D H+Y + ++ ++ +NLK Sbjct: 521 KYDEFGHEVDLVHNYM-NFMQMDEFVVNLK 549 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 265 LQNYLSIVWLCSHYHLLHFLVFTT 336 LQN + I W+ Y LL ++ T Sbjct: 85 LQNIIDICWITMVYSLLGIIIAYT 108 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 22.2 bits (45), Expect = 4.5 Identities = 11/30 (36%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = +3 Query: 456 EYDEHGNEID-QHSYTPSQVESEKSSLNLK 542 +YDE G+E+D H+Y + ++ ++ +NLK Sbjct: 521 KYDEFGHEVDLVHNYM-NFMQMDEFVVNLK 549 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 22.2 bits (45), Expect = 4.5 Identities = 11/30 (36%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = +3 Query: 456 EYDEHGNEID-QHSYTPSQVESEKSSLNLK 542 +YDE G+E+D H+Y + ++ ++ +NLK Sbjct: 147 KYDEFGHEVDLVHNYM-NFMQMDEFVVNLK 175 >AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc finger domain-Z1 isoform protein. Length = 111 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +1 Query: 208 RTVMRVHLYPSKQS*L**CLQNYLSIVWLCSHYHLLH 318 R + VH PSK+ C + Y S+ L +H + H Sbjct: 20 RHIQNVHTRPSKEPICNICKRVYSSLNSLRNHKSIYH 56 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 67 KMFEHSVKVPRHYKI 111 + FEHS K+ RH +I Sbjct: 155 RAFEHSGKLHRHMRI 169 >AM158085-1|CAJ43389.1| 171|Apis mellifera globin 1 protein. Length = 171 Score = 21.4 bits (43), Expect = 7.8 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = -3 Query: 101 CLGTLTECSNILDF 60 C G +T +N++DF Sbjct: 86 CAGVITALNNVIDF 99 >AM158084-1|CAJ43388.1| 171|Apis mellifera globin 1 protein. Length = 171 Score = 21.4 bits (43), Expect = 7.8 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = -3 Query: 101 CLGTLTECSNILDF 60 C G +T +N++DF Sbjct: 86 CAGVITALNNVIDF 99 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,641 Number of Sequences: 438 Number of extensions: 2960 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -