BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_B09 (651 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 22 5.0 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 22 5.0 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 21 6.7 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 21.8 bits (44), Expect = 5.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 303 ISSLPVPTQKNTETVNTLT 359 ISS P+P +T T TLT Sbjct: 156 ISSTPLPPTTSTTTRTTLT 174 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 21.8 bits (44), Expect = 5.0 Identities = 18/62 (29%), Positives = 25/62 (40%) Frame = -3 Query: 649 LIHNLLDIMKTR*AEGNLAQCFSVGISNCKQMWNGNSDAKHQFELPSWYSSANCMSNEST 470 +IHNLL E N AQ V +S +++ +D +F S A ST Sbjct: 216 IIHNLLSDKNPPNTENNCAQPVVVIMSPTRELAIQIADQGKKFAYNSTVKVAVIYGGTST 275 Query: 469 VH 464 H Sbjct: 276 NH 277 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 21.4 bits (43), Expect = 6.7 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +1 Query: 523 TDVLHHCYHSTFVY 564 +D LHH H T +Y Sbjct: 39 SDKLHHPIHQTVIY 52 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,925 Number of Sequences: 336 Number of extensions: 3409 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -