BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_B09 (651 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-tran... 24 4.8 AJ973470-1|CAJ01517.1| 117|Anopheles gambiae hypothetical prote... 23 6.3 AJ697733-1|CAG26926.1| 117|Anopheles gambiae putative chemosens... 23 6.3 >AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-transferase D6 protein. Length = 222 Score = 23.8 bits (49), Expect = 4.8 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +3 Query: 426 YIPK-VESDIADTVWTVDSLLMQLAEEY 506 YIP V++D VW ++L+ LAE Y Sbjct: 54 YIPTLVDADGDVVVWESSAILIYLAERY 81 >AJ973470-1|CAJ01517.1| 117|Anopheles gambiae hypothetical protein protein. Length = 117 Score = 23.4 bits (48), Expect = 6.3 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -1 Query: 558 KCGMVTVMQNISLNCLPGILQLTA*VTNLLSTQY 457 K + V+Q NC P Q +TN L T+Y Sbjct: 70 KAALPEVIQRNCRNCSPQQAQNAQKLTNFLQTRY 103 >AJ697733-1|CAG26926.1| 117|Anopheles gambiae putative chemosensory protein CSP4 protein. Length = 117 Score = 23.4 bits (48), Expect = 6.3 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -1 Query: 558 KCGMVTVMQNISLNCLPGILQLTA*VTNLLSTQY 457 K + V+Q NC P Q +TN L T+Y Sbjct: 70 KAALPEVIQRNCRNCSPQQAQNAQKLTNFLQTRY 103 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 672,001 Number of Sequences: 2352 Number of extensions: 12345 Number of successful extensions: 21 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -