BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P05_F_B09 (651 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 23 2.6 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 7.8 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 7.8 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +3 Query: 435 KVESDIADTVWTVDSLLM 488 K+E D+ D +W +DS L+ Sbjct: 124 KIEIDMCDRLWVLDSGLI 141 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 7.8 Identities = 16/63 (25%), Positives = 22/63 (34%), Gaps = 3/63 (4%) Frame = +3 Query: 45 YIYTFYIKPKLNSSVIYIYIKV---NCTYFIMNESFLNPIPEPKKIGVWAEGTHIEAKEF 215 YIY+ Y +I + C YF N L G T + KE+ Sbjct: 140 YIYSLYTAVITRPDTKFIQLPPLYEMCPYFFFNSEVLQKANHALIFGKLDTKTSGKYKEY 199 Query: 216 MIP 224 +IP Sbjct: 200 IIP 202 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 7.8 Identities = 16/63 (25%), Positives = 22/63 (34%), Gaps = 3/63 (4%) Frame = +3 Query: 45 YIYTFYIKPKLNSSVIYIYIKV---NCTYFIMNESFLNPIPEPKKIGVWAEGTHIEAKEF 215 YIY+ Y +I + C YF N L G T + KE+ Sbjct: 140 YIYSLYTAVITRPDTKFIQLPPLYEMCPYFFFNSEVLQKANHALIFGKLDTKTSGKYKEY 199 Query: 216 MIP 224 +IP Sbjct: 200 IIP 202 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,807 Number of Sequences: 438 Number of extensions: 3603 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -